KEGG   Maylandia zebra (zebra mbuna): 101468680
Entry
101468680         CDS       T02814                                 

Definition
(RefSeq) adapter molecule crk
  KO
K04438  C-crk adapter molecule crk
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101468680
   04012 ErbB signaling pathway
    101468680
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101468680
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101468680
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101468680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101468680
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   101468680
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 hSH3
Other DBs
NCBI-GeneID: 101468680
NCBI-ProteinID: XP_004551266
UniProt: A0A3P9BWY5
LinkDB
Position
LG10
AA seq 319 aa
MAGNFDAEDRASWYWGRLSRQEAVSLLQGQRHGVFLVRDSITIPGDYVLSVSENSRVSHY
IVNSISNNRQSGSGLAPSRFRIGDQEFDGLPALLEFYKIHYLDTTTLIEPVNRGRQSGLI
SPPAVGPPQQTEEGEYVRALFDFPGNDYEDLPFRRGDILRVLEKPEEQWWHAKNQEGRVG
MIPVPYVERFRPSSPTAASLSPVPAGTGQGGHVGGVMGSTDGTGSPQATALGEPGPYAQP
VVNTQLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDTVKVTKINVNGQWEGECKGKRG
HFPFTHVRLLEQYYPDDES
NT seq 960 nt   +upstreamnt  +downstreamnt
atggccggtaattttgatgccgaagaccgtgcaagctggtattgggggagactgagccgc
caggaggcggtttctcttttacagggacagagacatggtgttttcctcgtgagggactcg
ataaccatccccggagactacgtgctctccgtgtcggagaactccagagtgtcccattat
atcgtcaacagtatcagcaacaacagacaatctggatcaggattggctccttctcggttt
cggattggggatcaggagtttgatgggctgccggctctgctggagttctacaagatccac
tacctggacaccacaacgctcatagagcctgtgaacagaggcaggcagtcaggcctcatc
agcccccccgctgtcggacctccccagcagaccgaggaaggcgagtatgtccgggcactg
tttgacttccctggcaacgactatgaggacctccccttccgcaggggggacatcttgcgt
gtgctggagaaaccagaggagcagtggtggcacgccaagaaccaggagggccgagtcggg
atgatccctgtgccttatgtggaaaggttccgaccctcttcgcccactgcagccagtctt
agtccggtacccgcagggaccggacaaggcggccatgttggcggggtaatgggcagcaca
gatggaacaggttctcctcaggccaccgctctgggggaaccgggcccgtatgctcagcct
gtggtcaacactcagctcccaaacctacagaacgggccggtctatgcccgggcaattcag
aagcgggtgcccaacgcttacgacaagacggcgctggctctggaggtgggggacaccgta
aaagtgaccaagatcaacgtgaacggccaatgggagggtgaatgcaaaggcaaacgaggc
cactttcctttcacccacgttcggttgttggaacagtactatccagacgacgagagctga

KEGG   Maylandia zebra (zebra mbuna): 101470907
Entry
101470907         CDS       T02814                                 

Definition
(RefSeq) adapter molecule crk
  KO
K04438  C-crk adapter molecule crk
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101470907
   04012 ErbB signaling pathway
    101470907
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101470907
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101470907
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101470907
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101470907
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   101470907
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 SH3_10
Other DBs
NCBI-GeneID: 101470907
NCBI-ProteinID: XP_004574612
UniProt: A0A3P9B662
LinkDB
Position
LG14
AA seq 315 aa
MAGNFDAEDRGSWYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGPGLAHPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPINKSKHPTFM
SAGPGGGPPPRLEDEYVRALFDFPGNDDEDLPFRKGDILRVLEKPEEQWWNAQNSEGRTG
MIPVPYVEKYRPASPNSVAGSSMSGAAPGGMGMLGNSDGSAGPSGAPLLGDPSQYAQPTP
LPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKRGHFPFT
HVKLLDQHNAEDELS
NT seq 948 nt   +upstreamnt  +downstreamnt
atggctggaaattttgacgcggaggaccgtggtagttggtactggggtcggttgagcagg
caggaggctgtgtctctgttgcaggggcagaggcatggcgtgtttctggttcgggactcc
atcaccagccccggcgactacgtgctttcggtgtcagagaactccaaagtctcgcattat
ataattaacagcatcagcaacaaccgacaatctggtccaggtttggcccatccaaggttc
cgtattggcgaccaggaatttgatgcactacctgctttgctagagttctataaaatccac
tacttggataccaccaccttaatagaacccatcaacaaatctaagcaccccactttcatg
agtgctggccccggtggaggccccccaccacgcctggaggatgagtatgttcgggcactt
tttgatttccccggcaatgacgacgaggatctcccattcaggaaaggtgatatcctccga
gtccttgagaaaccagaggagcagtggtggaacgcccagaactcggaaggccgcacaggg
atgatcccagtgccgtacgtggagaagtaccgaccggcatcccccaattcggtggcgggg
tctagcatgtccggtgctgcacctggtgggatggggatgctggggaactctgacggctct
gcaggaccgtctggcgctccactgctgggagaccccagccagtacgcccaacccacaccc
ctcccaaacctccagaacggacctgtctatgccagggcaatacagaagagggtgcctaat
gcctatgacaagacagccctggctctagaggtgggggacatggtgaaggtgaccaaaatc
aacgtgaacggccaatgggagggggaatgcaaaggcaagcgcggccactttcccttcacg
catgtcaaactgctggaccagcacaatgccgaggacgagctcagctga

KEGG   Maylandia zebra (zebra mbuna): 101472174
Entry
101472174         CDS       T02814                                 

Gene name
crkl
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101472174 (crkl)
   04012 ErbB signaling pathway
    101472174 (crkl)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101472174 (crkl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101472174 (crkl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101472174 (crkl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101472174 (crkl)
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   101472174 (crkl)
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9
Other DBs
NCBI-GeneID: 101472174
NCBI-ProteinID: XP_004538286
UniProt: A0A3P9CNH5
LinkDB
Position
LG7
AA seq 305 aa
MSTARFDSSDRSAWYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSH
YIINSLPSKRFKIGDQEFDHLAALLEFYKIHYLDTTTLIEPAPRYSSTPSPPVQPMVGAE
ENLEYVRTLYDFTGSDAEDLPFKKGEILIILERPEEQWWSAKNKDGRVGMIPVPYVEKVV
RPSPHPVQPSHGSRNSNSYGIPEPSNALAHAYAQPQTPSPMPNAPGAVIAPLPSMQNGPV
MAKAIQKRVPCAYDKTALALEVGDIVKVTRMNISGQWEGEVNGRRGLFPFTHVKIIDPQN
PEESD
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtcaactgctcgatttgattcctctgatcggtccgcctggtattttggacccgtgtca
cgacaggaggcacagaataggttacaaggacagagacatggcatgtttcttgttcgagac
tcgtcgacctgccccggcgactacgtactgtcggtgtcggaaaactccaaagtgtctcac
tatatcatcaactctttgcccagcaagaggttcaaaataggggatcaagagttcgaccac
ctcgcagctctcctggagttctacaaaatccattacttggacacgaccacgctgatagag
ccagcccccaggtattcaagtacgccgagtcctcctgtccagcccatggttggagcagag
gagaatctggagtatgtgcggactctgtacgacttcaccgggagcgatgctgaggacctt
cccttcaagaagggggagatccttatcatcctggaaagaccggaggagcagtggtggagc
gccaagaataaagatggacgtgttgggatgatccctgtgccctacgtagagaaagtggta
cgaccttcaccccaccctgtccaaccttctcatggatcgcgaaactccaacagctatggg
atccctgagccctccaatgctcttgctcatgcctatgcccaaccccagacgccttctcca
atgcccaacgcacctggagcagttatcgctccgctaccgtccatgcagaatggccctgtc
atggcgaaagccatccagaaacgagtgccctgtgcctacgacaagactgctcttgctcta
gaggttggtgacattgtcaaggttacgcggatgaacatcagcggtcagtgggagggagag
gtgaacggacggaggggtctcttcccgttcacccatgtcaaaatcatagacccccagaat
ccagaggagagtgactga

DBGET integrated database retrieval system