KEGG   Maylandia zebra (zebra mbuna): 101468797Help
Entry
101468797         CDS       T02814                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04210  Apoptosis
mze04625  C-type lectin receptor signaling pathway
mze04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101468797
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101468797
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101468797
   04672 Intestinal immune network for IgA production
    101468797
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101468797
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101468797
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  Other
   101468797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 101468797
NCBI-ProteinID: XP_004552299
LinkDB All DBs
Position
LG4
AA seq 874 aa AA seqDB search
MQFRLASIDLEDNMAVRQRLFNSTAPFTGPPKADLKGTYPSCSNAEQETEEAQDEGKDGK
MGFTQKWSADKLTKLLTHGTAEQVEEMQFKTSTIVAQAECETQDSQEFSPSCYDRSFRAF
PKCLTTSLSSDQNNVACQTMATIQEASTSILSSRKSTHRRQKRKGKRKKQQKKKDKQRQR
RRMPSGVPEQESGSSLIPILGDSSVEERSDLSTSCCSSFESSEEDARRASFYSQQVYNKG
SSCSPLNWPVLGNLSSVRSYEHNSSSDSLSSVGDCSLALAGLRGLVSQGDPCYTGPFFKE
VERETREDEDEFSEADSVSNEGLIFYHEKIQPVDSEYKEGREYVLQHFIKEGSYGEVHSA
EDVNSGFKFAAKKIALKRFNSEEVGAWSALRSPHVVKLFGVVREGPNVVLLMEHKAGSLG
QLIVERGRLPEDLSLHYHSQVLTALEYLVKKRVVHLDIKADNVLLSDDGRDTFLCDFGHA
ERLDNQGQSLSRSKDLKGTETHMAPEIIKGEPRGAKADVWSSCCMLLHMLNGCQPWTRYY
NCRLYLKIANEPPPLREIPPDCGSLTAEVIKAGLQKDPLKRSSATDLREKTDRALREVGG
LTNPVKGPYLEPLLNTNKPSDSMQLISSSADFEDEEMHQESMEKLITTGRRTKKLTDEEE
ADADSKKSKRGSPHEPQMLISELSHKRDNKITTVPELELRKLVGDFYLSSLSQLHSAEMQ
EQLLSCLSSDPYSNWEPLDKKDSGRWSLSPGDDLSSGVFSYNSQPDVQVFSLDFLGHTQQ
PPPCCFEGVDVCIRDFSDKKIRIREMRRVKVGHIATGISDQISERVYTLKTEHGQQIGHD
EEVQESGLELRCFPAPDFSTSWRWRIKDGMLETR
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagactggcatctattgatttagaagataacatggcggtgagacagaggctc
ttcaactcaacagcgcctttcactggaccaccaaaagctgacctgaaggggacatatcca
tcatgctccaatgcagagcaggagactgaggaggcgcaagatgaggggaaggatggcaaa
atgggatttacgcaaaagtggtctgctgataaactcactaaactcctgacacatggaact
gcagaacaagtggaagaaatgcagttcaagacctcaaccattgttgctcaggcagaatgt
gaaacccaggactcccaagagttcagcccgtcctgttatgaccgctccttccgtgccttc
cctaaatgcttaaccaccagtctttcatctgaccaaaacaatgtggcgtgccaaacaatg
gccaccatccaggaagcaagcacatcaatactctcctcaagaaagagtacccataggaga
cagaaacgtaaggggaagaggaagaagcagcagaagaagaaggacaagcagcgacagaga
cgtcgaatgccttctggagtgcctgaacaagaaagtggaagttctctgatcccgatcctg
ggggactcttctgttgaagagagaagcgatctcagtacctcttgctgtagcagctttgaa
agctcagaggaagacgcccgaagggcttctttttacagccaacaagtttacaacaaaggc
tcaagctgttcccctttgaactggccagttttgggtaacctctccagtgttcggtcatat
gagcacaacagcagctcagactctcttagcagtgtgggagactgctcactggcccttgct
gggctcagaggccttgtcagtcagggggatccatgctacacagggccatttttcaaagaa
gtggagagggagactagggaagacgaagacgagttctcggaagctgactctgttagcaat
gagggactcattttttatcatgaaaaaattcagcctgtggactcagaatacaaagaaggg
agagagtatgtcctccagcacttcatcaaggaaggctcctatggtgaagtacacagtgct
gaagatgtgaacagtgggttcaaatttgctgccaaaaagattgccctgaagaggttcaac
agtgaggaggtgggtgcgtggagtgccctcagatctcctcatgtggtgaagctctttgga
gtggttagagaggggcctaatgtcgtccttctgatggaacacaaagctggctctttgggc
cagctgatagtggaacgtggtcgactgccagaggatttaagtctccactaccactctcaa
gttttaacagcgttggagtacttagtgaagaaaagggtggtgcatctcgatattaaagcc
gacaacgtgttgctgtcggacgatggtagagacaccttcctatgtgactttggacatgcc
gaaaggctcgacaatcagggtcagagcctcagtaggtccaaagatctgaagggcacagag
actcacatggcccctgaaataataaaaggagaaccccgcggagctaaagcagatgtgtgg
agcagctgctgtatgttactgcacatgctcaatggttgtcagccttggacaagatactat
aattgtcgcctttacttgaagattgctaacgagcccccgcctctgagagagatcccacct
gactgtggctctctcactgctgaagttataaaagcaggactccagaaggatccactgaag
agatcatcagcaactgacctcagagaaaaaactgacagagctctaagagaagttggagga
ctcaccaacccagtgaagggtccctatttagagcccttgcttaacaccaacaaaccaagt
gactccatgcaactcatcagcagcagtgctgactttgaggatgaagagatgcaccaagag
tccatggaaaagctgatcacaacagggaggaggacaaagaaactgactgatgaggaagag
gcagacgctgattctaagaaatcgaaacgaggctcgcctcatgaaccacaaatgctgatc
tcggagctgagccacaagagggacaacaaaatcaccacggtacctgaacttgagctacgg
aagctggttggagatttctatctgagcagcctctcccagcttcattctgctgagatgcag
gagcagttgttgtcttgcctcagcagtgacccttactcgaactgggaaccattggacaaa
aaggactctggccgctggtctctgagcccaggagacgacctcagctccggtgtcttctcc
tacaatagccagccagatgtgcaggtgttcagtttggatttcctgggtcacacacagcag
ccaccaccttgctgttttgaaggggtggatgtctgcatcagagactttagtgataagaaa
atccggatcagagagatgcgtcgggtgaaggtgggccatattgccactggaatcagtgat
cagatctctgagagggtttacacactgaaaactgagcacggccagcagattggtcacgat
gaggaggtacaagagtccggcctggagctccgctgttttccagctccagacttcagcact
tcttggagatggagaatcaaagatggcatgctggaaactcgatag

DBGET integrated database retrieval system