KEGG   Maylandia zebra (zebra mbuna): 101468872Help
Entry
101468872         CDS       T02814                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00052  Galactose metabolism
mze00500  Starch and sucrose metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101468872
   00500 Starch and sucrose metabolism
    101468872
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101468872
    3.2.1.20  alpha-glucosidase
     101468872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101468872
NCBI-ProteinID: XP_024659087
LinkDB All DBs
Position
LG7
AA seq 1815 aa AA seqDB search
MGRRRFSGLGVTLMDLFMPMTATAITFLVLSATTVSAVKKGTTKAFVPTCPNIPLGERVD
CFPDPGASQENCEARGCCWSPRDESNVPWCFFPTNHGYTVESQDSSSPYVLKANLIRMDS
PSLFGGEIKQLSLEAEMQTNNRLRFKIYDPNSNRFEVPHEHISSLPSNPSIPISSTLQVT
QKPFGLTVRRKENQKVVFDTTIAPLVFEDQYIQLSARLPSHNIYGLGEHVHRQYRHDTNW
KTWPIFTRDAFPNGGTHNLYGHYPFFLCLEDESGKSFGVFLLNSNAMDVTLQPAPAVTYR
TIGGLLDFYIVFGDTPEQVVQEFLELTGRPVMPPYWSLGFQLSRWNYTNLDIVKETVERN
RAVGLPYDVQYTDIDYMENKKDFTYDKLNYTELPRFADYLHERGQKYILILDPAIATSKR
VGDAPYESYDRGTAKNAWVTESDGKTPLIGEVWPGETVFPDYTNPNCIDWWVDEYERFSK
EVKHDALWIDMNEIANFKQGSSKGCAVNKLNYPPYIPKILDDLMYSKTLCMDAKQTWGNH
YDVHSLYGYSMVLATKKAMDRVFGENRSMMLTRSSFPGVGKYSGHWLGDNAATWNDMKWA
IPGMLEFGLFGIPYIGADICGFFDDSPEELCRRWMQVGAFYPFSRNHNAEGYKPQDPASY
GADSVLVASSKHYLTIRYTLLPYLYTMFYKAHTTGETVVRPVMHEFYSDSETWTVDRQFL
WGKHLLITPVLDPGVDMVWGYVPDALWYDYESMQKLTVRKTHMEMYLPADKLGLHIRGGA
ILPTQEPDVTTTYSRRNPMGLLIAPDDNGNADGELFWDDGDSRDTIENGNYIHYKFSLKQ
GVLTMQVTHAGYSDPNNLKFDNITILGIPVPPVSISVTHVGTTNSTTTLEPSNIHHDGDK
KVLFLRDLRLTLGETYVLEWEVIRIDCHPEEHADQANCEARGCIWDPITSGQGPWCIYPQ
DYGYTVTSVRERSSGMTLDITRNRKYRSSGRPQSRDIDTLRVEINYHTGEMLQFKIFDPN
TKRYEVPVGLSLPATPETDENKRLYKVVIVNEPFGIQVIRKSTGTVIWDSSVPGFTFSDM
FIQVSTKLPSQYVYGFGETEHLTYKHDLNYHTWGMFAKDQPPGYKMNCYGVHPFYMGLEN
TADAHGVLLLNSNAMDVTFLPDPALTYRTLGGILDFYMVLGPTPEMVVQEYTELIGRPVL
PAYWSLGFQLCRYGYANDKEIADLYKDMRAAAIPYDVQYADIDYMERQLDFVLDSEFKGL
PALVDSMRKEGMRFIFILDPAISGNETQPYPAFARGKAADVFIKWPKHISDGIVWGKVWP
DYPNVTVDENLDWDTQVQLYRSYTAFPDFFRPETAQWWHQEIKEFYEKTMKFDGLWIDMN
EPASFVHGTVDGKCLGDPKLENPPYMPPLESKHLGLNHKTLCMNSEQILSDGTRVRHYDV
HNLYGWSHTKPTYDAVLDVTGKRGIVVTRSTYPSSGKWAGHWLGDNNASWDQLYKSIIGM
MEFSLFGIPYTGADICGFFNKPDYEMCLRWMQLGAFYPYSRNHNGKGNPRQDPVAWDKPF
AEASRDVLNIRYTLLPYLYTLMYEAHTKGNTVIRPLLHEFVDDKSTWEIYKQFLWGPALL
ISPALDPGVTNVNGYLPNARWYDYHTAGDVGVRGQMINMPTPLDHINLHIRGGYILPWQK
PENTTYYSRKNPLGLIVPLSDSGTAEGSLFWDDGEGIDTVETNKYLLISFSAQSNTLSSQ
VTHNGLTAGDRLKLGVVKVWGAGSTKITKVTLTVAGVAHNLTPEHNVDSQELIIDATSKD
VYVDQPFIITWQTSV
NT seq 5448 nt NT seq  +upstreamnt  +downstreamnt
atggggaggagacgcttctctggcttgggggtgaccctaatggatctgttcatgccgatg
accgcgactgcaatcacctttttagttctgtctgccaccacagtatctgctgtcaaaaag
ggaacaactaaagcatttgtccctacctgtcccaacattcctcttggcgagagagtagac
tgcttccctgatcctggagcttcccaggaaaattgtgaggcgcgtggatgctgttggagc
ccacgggatgagagtaacgttccctggtgtttcttcccaaccaaccatggatacaccgtg
gaatcgcaggattcatcaagcccttacgttcttaaagcaaacctgataagaatggattct
ccgtctttattcggtggggagataaaacaactgtcgcttgaggcagaaatgcagacaaac
aatcgtctccgatttaagatctacgatcccaacagtaacagattcgaggtcccccatgaa
cacatcagcagtcttcccagtaacccatccattcccatcagcagcacactgcaggtcaca
cagaaaccctttggccttactgtgcgcaggaaggagaaccagaaagttgtgttcgacacc
acaatcgcaccactggtgtttgaagatcagtacatacagctgtctgccagacttccatca
cataatatttacggcctcggggagcacgtccacaggcagtatcgccatgacaccaactgg
aaaacctggccaattttcaccagagacgctttccctaatgggggaacacacaacctctac
ggacactatcccttcttcctctgtctggaagatgagagtggaaagtcattcggggtcttt
ctcttgaacagcaatgctatggatgtgacactgcagcctgccccagctgtgacctacagg
actattggagggcttcttgacttctacattgtctttggtgacacaccggaacaagtggtg
caggagttcctcgagctcactggcaggcccgtcatgcctccctactggtcactgggattc
cagctttctcggtggaactacaccaacctcgacatagtcaaggaaacagtggagagaaac
cgtgctgtgggcctcccatatgatgtccaatacaccgacatagactatatggagaataaa
aaagatttcacctatgacaagcttaactacactgaacttcctcggtttgctgactatctc
catgagagggggcagaaatacatccttatcctggatcccgcaatagccaccagcaagagg
gttggagatgctccatatgagtcttatgaccgtggcactgcgaagaatgcttgggtcact
gaatcagatgggaagactcctctgataggagaggtgtggccaggggagaccgtgtttcca
gactacaccaaccccaactgcatcgattggtgggtggatgagtacgagcggttctccaag
gaggtcaaacacgacgcactttggattgacatgaatgagattgctaatttcaagcaagga
tcatcgaagggctgtgctgttaacaaactcaactaccctccctacattccaaaaattttg
gatgacctcatgtacagtaagactctgtgtatggatgccaagcaaacctggggcaaccac
tatgatgtccacagtctgtatggctactctatggtcctggctactaagaaagctatggac
cgtgtgtttggagaaaaccgctccatgatgctgacccgctcttcctttccaggtgtggga
aaatattcaggtcactggctaggcgacaatgctgccacctggaatgacatgaaatgggct
atccctggcatgctggagtttgggctctttggaataccctatatcggagccgacatctgt
ggtttctttgacgactcccctgaagagttgtgccgtcgctggatgcaggtcggcgctttc
tatcccttcagtcggaaccacaacgctgagggctacaagcctcaggatccagcttcatat
ggcgctgactcagtactggtggcgagttctaaacattacctgacgatacgttacacactt
ctgccttacctctacacaatgttctacaaagcccacaccacgggcgagactgttgtacgt
cccgtcatgcatgaattctactctgatagtgaaacctggacagtggatcgccagttcctt
tggggaaaacacctgctcatcacacctgtactggatcctggcgtagacatggtgtgggga
tatgtaccagatgctctgtggtatgactatgagtcgatgcaaaagctaacagtccgaaaa
acacacatggaaatgtatctaccagctgacaagctcggattacacattagaggtggagct
atcctccccacacaggaacctgatgtcactaccacatacagtcggcgtaacccaatgggt
ttgctcattgctcctgatgacaacggcaatgcagatggggaactattttgggatgatgga
gattccagagatacaattgagaatggcaactacatccactacaagttctctcttaagcag
ggagttctgactatgcaggtgacccatgctggttacagtgatccgaacaacctgaagttt
gacaacatcactatccttgggatacccgttcctcccgtgtccatctctgtgactcatgtt
ggcaccacaaactctactaccacattagaacccagcaacatccaccacgatggagacaag
aaggtgctgttcctgcgtgacctcagactgaccctcggggagacctacgtgttggagtgg
gaagtgatacgcatcgactgccatccagaggaacatgcggatcaggctaactgcgaggcc
agaggctgcatctgggatccaattaccagtggacaaggcccatggtgcatctatcctcaa
gactatggttacactgtcacgtcagtacgggaaagaagctcgggcatgacacttgacatc
actaggaacaggaagtacaggagcagcggtcgtccacagtcacgggatattgacacactc
cgtgttgagattaattatcacaccggtgaaatgctgcagttcaagatctttgacccaaac
acaaagcgctatgaggtaccagtgggattgtcacttcctgccactcctgagactgatgag
aacaagagactttacaaggtggtcattgtgaacgaaccattcggcatccaggtcattagg
aaaagcacaggaaccgtaatctgggattcatctgtgccaggctttaccttctcagacatg
ttcatccaagtgtcaactaagctgccatctcagtatgtttatggttttggggaaacagag
catctcacttacaagcacgatctcaactatcacacctggggcatgtttgccaaggaccag
cctcctggctacaagatgaattgctatggagtccatcctttctacatgggccttgagaac
acagctgatgctcacggtgtgctgctgctaaacagcaatgcaatggatgtgaccttccta
cctgatccagctttaacctaccgaactctgggtggcatcctggatttctacatggtcctg
ggacctacgcccgagatggtggtgcaggagtacactgagttgattggacgacctgttcta
cctgcctattggtctcttgggttccaactctgtcgctatggttacgccaatgacaaggaa
atagcagacttatacaaagacatgagggcagctgctataccctatgatgtgcagtatgca
gacattgactacatggagcgtcagctggactttgtcctggactcagagtttaaaggactg
ccggcactcgttgacagcatgagaaaagagggcatgagattcatcttcatcctggatccc
gctatctcaggcaatgagacccagccctacccagcctttgcgagaggcaaagcagcggat
gttttcatcaagtggcccaaacacatcagtgatggaattgtgtggggcaaggtctggcct
gattatcccaacgttacagtagatgagaatctggactgggatacccaagtacagctctac
aggtcatacaccgcattcccagacttcttccggccagaaacagcacagtggtggcaccaa
gaaatcaaagaattctacgagaaaacgatgaagtttgatggcctttggatcgacatgaat
gaacctgccagttttgtccacggcacagttgatgggaaatgtcttggtgatccaaaacta
gagaacccaccatatatgccacccttggagtccaaacatcttggcttaaaccacaagact
ctgtgcatgaacagtgaacagatactcagtgatggaacgagagtcagacactatgatgtc
cataacctgtacggatggtcgcacaccaagccaacctatgatgccgttctggacgtgact
ggtaaaagaggcatagtggtcaccaggtccacctacccctctagtggaaaatgggctgga
cattggctcggagacaacaatgccagctgggaccagctttacaaatccattattggtatg
atggagttcagtctctttggaatcccttacaccggggcagacatttgcgggttctttaat
aaacctgactatgagatgtgtctccgttggatgcagctgggtgctttctatccatactca
cgcaaccacaatggcaagggcaacccgagacaagatcctgttgcttgggataaaccattc
gccgaagcaagccgggatgtcctgaacatccgttacaccctcctgccctatttgtacacg
ctgatgtatgaggcacatacaaaaggaaacacagtgatcagaccacttttgcacgagttt
gtggacgacaaatctacatgggaaatctacaaacagttcctttggggacctgccctactt
atcagccccgcacttgacccgggagtcacaaatgtgaatggctatcttcccaacgcacgc
tggtatgactaccacacagccggagatgttggagtgcgtggccaaatgattaacatgccg
acacccttggaccatattaacctgcacatcagaggaggatacatcttaccctggcagaag
cccgagaacactacatactacagccggaagaatcctctaggactgatcgtccctctgagt
gacagcggcaccgctgaaggatctttattctgggatgatggcgagggaattgacacggtg
gagaccaacaaatatcttctgatctcattttcagcacagtcgaacaccttgtccagtcag
gtgacccacaatggtcttactgctggtgatcggctgaagctgggcgtcgtgaaggtttgg
ggtgcaggcagtactaagatcacaaaggttaccctgactgtagctggagtggcacataat
ctcaccccagagcacaacgttgactcccaggagctgattattgatgcgacttcaaaggat
gtttatgtggatcagcctttcatcataacatggcaaaccagtgtctga

DBGET integrated database retrieval system