KEGG   Maylandia zebra (zebra mbuna): 101469224
Entry
101469224         CDS       T02814                                 

Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101469224
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101469224
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mze03310]
    101469224
Transcription factors [BR:mze03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101469224
Nuclear receptors [BR:mze03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101469224
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 101469224
NCBI-ProteinID: XP_004541006
UniProt: A0A3P9C0Z8
LinkDB
Position
LG2
AA seq 779 aa
MDKGGVKKIAYRRDDHLSKLVYTESPEEGGLLRVAPHSAMSVTSPASVVLPSSSLMQPGQ
VPNGLNNNTLPEELTSASVTATVGSLIDSPQPRGLTKDQRPQHQQLLQTQTTFGHQTLSE
NLSQLDASMADITQSSMDSLIGGSDPNFFPLKTEDFSLDKGEQDPIDLDNAFEPIGKDMD
VNQKLFSDNTLDLLQDFDLSGSPSDFYVGDDAFLSSLADDSLLGVTSERDIKPAVVDSSN
TTGAVPVALNGNSVTSPDLSSPTISTTTSLSPTTTLSAMVKKEKDADFIQLCTPGVVKQE
KTSGGQSYCQISGTASGDMAGTNAISVCGVSTSGGQTYHFGVNTLSSDTPLQNEQKPVSS
LFLPVTTIGGIWNRGQGIGNNSLVQRAGEGFSSSPSYPTSFTRQEGSTATSSTQGKSGTH
KICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRF
RKCLMAGMNLEARKLKKNRLKGVQQSNPPEVTPSPPVETRSLVPKCMPQLVPTMLSLLKA
IEPDTIYAGYDSTLPDNSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQY
SWLFLMTFSLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMTDQFEQMLKISSEFVRLQV
SHDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQL
TKLLDSMHEMVGGLLSFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQR
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggataaaggtggagtgaagaagatagcatacagaagagatgaccatttaagcaaactg
gtctatactgaaagccccgaggagggaggtctgttgagagtagctcctcacagtgccatg
tctgtcacctctcccgcctctgtcgttcttccatccagctctttgatgcagccaggacag
gtgcccaacggcctcaacaacaacacccttcctgaggagctcacctctgcctctgtcact
gccaccgtaggctcgttgatcgacagtccacagccccggggattgaccaaagatcagaga
ccccagcaccagcagttacttcagacgcagacgacttttggtcatcaaaccttatcagaa
aatttgtcccagttggatgccagtatggcagacatcacccagtcctccatggattcgcta
attgggggatcagatcccaacttcttccctttgaaaacggaggacttctccttggataaa
ggagagcaggacccaattgaccttgataatgcctttgagcccattgggaaagatatggac
gtgaaccaaaagttgttcagtgacaacactctggatctgctgcaggactttgacctctct
gggtccccttcagatttttatgtaggggatgatgcttttttgtcttctcttgcagatgat
tctttgcttggagtgacatccgagagggacataaaacctgctgtagttgacagcagtaac
acgactggggcagtgcctgttgcccttaatggcaacagtgtgaccagtccagatctatcc
agccctaccatatccacaactacttcactatcccctacaaccactttgtctgcaatggtg
aaaaaagaaaaagatgcagacttcatccagctctgcaccccaggtgtggttaaacaggag
aagacctctggaggacagagttattgccaaattagcggcacggcttctggagacatggct
gggactaacgccatctcagtctgtggggtcagcacttcaggaggacagacctaccacttt
ggtgtgaacacactgagcagtgatactccgctgcagaatgagcagaagccagtttccagc
ctgtttctcccagtaacgaccatcggtgggatctggaaccgaggccagggtattggtaac
aactcattagtccagagggctggtgaggggttctcaagttccccctcctaccccaccagc
tttaccaggcaggaagggagcaccgctacatcctccacacaaggaaagagcgggactcat
aaaatctgcctggtgtgctctgatgaggcttcgggctgccactatggcgttctcacctgc
ggcagctgcaaagtcttcttcaagagagcagtagaagggcaacataattacctgtgtgca
gggaggaatgactgcataatagacaaaatcaggaggaagaactgcccagcctgccgattc
cgaaagtgtctgatggcaggcatgaatctggaagctcgcaaattaaagaagaatcggtta
aagggcgtccagcagagcaacccaccagaggttacaccttcaccgccagttgagacccgc
tccctcgtacccaagtgcatgcctcagctcgttccaacaatgttatccctgctgaaggcg
atagagccagacaccatctacgctggctacgacagcaccctgcccgacaactccacccgc
ctcatgaccaccctcaacaggcttggaggccgacaggtcatctctgccgtcaagtgggcc
aaggccctgccaggtttcaggaacctgcacctggatgaccagatgactctgctgcagtac
tcctggctcttcctcatgacttttagtttgggctggaggtcttaccagcagtgcaacggc
aacatgctctgctttgcgccagacctcgtcatcaatgaggagaggatgaagctgccctac
atgaccgaccagtttgagcagatgctgaagatttccagcgagtttgttcggctgcaggtt
tcccacgatgagtacctgtgcatgaaggtcctgctgctgctcagcacagtgccaaaggac
ggcctgaagagccaagcagtgtttgatgagattcgcatgtcgtatatcaaggagctagga
aaagccattgtgaagcgtgaggagaactccagccagaactggcagcgattctatcagctc
accaagttgctggattccatgcatgagatggtcggtggtctgctgagtttctgcttctac
acctttgtgaataaatccctgagcgtggaattcccagagatgctggcagagatcatcagc
aaccagttgccaaaattcaaggctgggagcgtcaaacctctgctcttccaccagagatga

DBGET integrated database retrieval system