KEGG   Maylandia zebra (zebra mbuna): 101469541Help
Entry
101469541         CDS       T02814                                 

Gene name
napepld
Definition
(RefSeq) N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D isoform X2
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     101469541 (napepld)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 101469541
NCBI-ProteinID: XP_004548284
LinkDB All DBs
Position
LG17
AA seq 398 aa AA seqDB search
MEKQSSSDRAELEERKGLVEDGGEPRGAEGGEVDARTPRKSSSSRKSFRLDYRLEEEVTK
SCRDKHGRWANPWPTWRFPSYSMLFRFLFLEKDNSNVPSSKEALDRELPVMEPYFVQNPN
LSGSGPGLRVTWLGHATVLVEIDGVNVLTDPIFSQRASPIQYMGPKRFRGPPCTVEQLPR
IDAVVISHSHYDHLDAGSVASLNARFGGELRWFVPMGLMDWLMKMGCENVMELDWWEENC
VPGHDDVTFVCTPSQHWSKRTAWDDNKSLWSSWTVLGPDHRFFFAGDTGYCSSFAEIGRR
FGPFDLAAIPIGAYLPRDVMKGQHVDPEEAVQIHEDLQARQSVAIHWGTFALAYEYYLDP
PLRLREALEQKGLKPDCFFTLHHGESRLISAQDEDVFD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcagtcatcttcagacagagctgagctcgaggagagaaaaggcctggtggag
gatggtggcgagcctagaggtgctgagggtggagaggtggatgctcggactccaaggaag
agcagctcctcccgcaaaagcttccgcctggactaccgactggaggaagaagtgacaaag
tcgtgtcgggacaaacatggccgctgggctaacccctggccaacgtggcgctttccttcc
tactcgatgctgttcaggttcctgttcttagaaaaagataacagcaatgtaccttctagt
aaagaggccctggatcgtgagctccctgtgatggagccatactttgtgcagaacccaaac
ctctctggctctggtccaggactgagagtcacatggctgggccatgccacagttctggtt
gaaatcgatggggtgaatgttctgacagatccaatcttcagtcagagggcatcgccgatc
caatatatgggacccaaaagattcagaggtcctccttgcactgtggagcagcttcctagg
attgatgcagtggtcatcagtcactctcattacgatcatctggatgctggatctgtggcc
agtcttaatgctcgcttcggaggagagctacgctggttcgtgccaatgggtttgatggac
tggctgatgaagatgggctgtgagaatgtgatggagctggactggtgggaggagaactgt
gtcccaggtcatgatgatgtcacgtttgtttgcacaccctcgcagcactggagcaaacgc
acagcatgggatgataacaaatctttatggagcagctggaccgttttgggtccagaccat
cgtttcttctttgctggcgacactggctactgttcttcctttgcggaaataggacgacgc
tttggaccatttgaccttgcagcaatccctatcggagcatacctgcccagagacgtgatg
aaaggacagcatgtagatccagaggaggccgttcagattcacgaggaccttcaggccaga
cagtcggtggccattcactggggcacctttgccctcgcgtatgagtattacctcgatcca
cctcttcgactcagagaggctttggaacagaagggactgaaaccagattgtttcttcact
ttgcatcatggggagtctcgccttatatctgcacaggacgaagacgtcttcgactga

DBGET integrated database retrieval system