KEGG   Maylandia zebra (zebra mbuna): 101469631
Entry
101469631         CDS       T02814                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
mze  Maylandia zebra (zebra mbuna)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2
Other DBs
NCBI-GeneID: 101469631
NCBI-ProteinID: XP_004548561
UniProt: A0A3P9C3F0
LinkDB
Position
LG5
AA seq 359 aa
MSKCELIELQDLSVNDPIELAAPAVHVAPSTANLGHPSHYCVVRLVGDNVSIEASGHHTG
ETGVGHDFQPYSHAHLTWCDLCGEFIWGLYKQSLRCTNCSYTCHYRCRPSIQLDCMTHGS
LLAEPAALSDDCIETDTNVDEQIELGKQELSVSEIQQKVKEYNAQISNNLYMVDNKDGSY
TGFIKVHFQLVRPISLPPPRQSLSLMQEDDYQGRRMKRRTSFYLPKDAAKHLHISSETRV
REVIEALLNKFTVVDNPAKFALFERTERQGQVYMRKLSDDERPLYLRLCAGPSETVLSLV
LKENETGDVNWHAFSFPELCNFLRILQREEEAHVREIVKRYALARDMMKQAMAPMTTPG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgatagagctgcaggatctcagtgtaaatgatcccatcgagctg
gccgctccagctgtccacgtagccccgtcgactgcaaacctgggtcatcccagccactac
tgtgtcgtccgtctggttggagataacgtcagcattgaggcctctggtcatcacacagga
gagactggtgtgggtcatgatttccagccatacagtcatgcacatctcacctggtgtgac
ctgtgtggtgaattcatctgggggctttataagcagagtttacgctgcaccaactgcagc
tacacttgtcactaccggtgccgaccgtccatccagctggactgcatgacacatggaagt
ttgttagcagagcctgcagctttatctgatgactgcatcgagacagacacaaatgtggat
gaacagatcgagttgggtaaacaggagttaagtgttagtgagattcaacagaaggtgaag
gaatacaatgctcagatcagcaacaatctctacatggtggataataaagatgggtcctac
actggtttcatcaaggtccactttcagttagttcgtcccatttccctccctcctccccgt
cagagtttgagcttgatgcaggaagatgattatcagggaagacggatgaagcggcggaca
tcattctacctccccaaagatgctgcaaagcacctacatataagctctgaaacacgggta
cgagaagtcatcgaagcactgctcaataagttcaccgttgtggacaacccggcaaagttt
gccttgtttgaacgcacagagagacaaggtcaagtgtacatgcgtaaactgtctgatgat
gagcgtcctctatacctgcgcttgtgcgctggccccagtgaaacagtcttaagcttggtt
ctgaaagagaacgagacaggggatgtaaattggcatgcatttagctttcctgaattgtgc
aacttcctgcgaatccttcagcgggaggaagaagcacacgtaagagagatcgtgaagcgc
tacgctcttgctagagacatgatgaagcaagccatggccccgatgactacaccgggttga

DBGET integrated database retrieval system