KEGG   Maylandia zebra (zebra mbuna): 101470034Help
Entry
101470034         CDS       T02814                                 

Gene name
fip1l1
Definition
(RefSeq) pre-mRNA 3'-end-processing factor FIP1 isoform X3
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    101470034 (fip1l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mze03019]
    101470034 (fip1l1)
Messenger RNA biogenesis [BR:mze03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     101470034 (fip1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 101470034
NCBI-ProteinID: XP_004557189
LinkDB All DBs
Position
LG23
AA seq 354 aa AA seqDB search
MNATDDRHEIQRVGLSPSTFMHLRRTQHVGGTTNDLLLEKVQGNEEINQKVEFLEKKPWR
KAGANISDYFNYGFDEESWNAYCRKQAKLHGMIRKAQKRHTGYEEEEVFCAYSSPGRPSI
VAFRDSDPITNLAGGQPESSREDGHQCHNDGGSNTQVVCEMCHYEDSSNTNQLPPPLSKN
SFFKFIKKRVPPRPQPPSSTATSVSGNSTSFNSPSASSRRITISPGVIDTTKARECYILQ
EKHDKDRDRSRAHGQDKENKRSRNREKEGCSSSYYREAQMKHREPRNQGYKYCYDRGSGK
KRKSNKDGSRKRSESSSVRSSRSSRDVGGNRDRRHKQKRNRKAKTCRKNKETSK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacagatgaccgacacgagatacaaagggttggactctcacccagtacattt
atgcatcttaggaggacacaacatgtaggtggtactacaaatgacctattgttagaaaaa
gtccaaggaaatgaagaaattaaccagaaagtagagtttttggagaaaaagccatggaga
aaagctggtgctaacatctcagattactttaactatggttttgatgaagaaagctggaat
gcttactgtaggaaacaagcaaaacttcatggcatgataagaaaggcccagaagaggcac
actggatatgaagaagaggaggtgttttgtgcttattcttccccaggcagaccatctatt
gtagctttcagagattcagatcctatcactaatttggctggaggacaacctgaatccagc
agagaggatgggcaccaatgtcataatgatggaggcagcaacactcaggttgtttgtgag
atgtgccattatgaggacagcagtaatactaatcagctgccacctccactcagcaagaac
tctttctttaaatttattaaaaagagagttccaccacgtccccaacctccctcctctact
gctacttcggtcagtgggaactctacaagttttaacagcccatcagcttcatcaagaaga
atcaccatcagccctggagtgattgataccaccaaggctcgggaatgctacatattgcag
gaaaagcatgacaaggatagagacagatccagagcgcatggtcaagataaagagaacaaa
agaagcagaaatagagagaaggagggctgctcctcttcctattatagggaagcacaaatg
aagcacagggagcctaggaaccaagggtacaagtattgctatgacagaggcagtggaaaa
aagagaaagagcaacaaagatggatcacgaaaaagatcagaaagcagcagtgtcaggagc
agcagaagtagcagagatgttggtgggaacagggacaggagacacaaacagaaaagaaac
agaaaagccaagacatgtaggaagaacaaggaaaccagcaagtag

DBGET integrated database retrieval system