KEGG   Maylandia zebra (zebra mbuna): 101470250
Entry
101470250         CDS       T02814                                 

Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform isoform X1
  KO
K05456  neuregulin 2
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101470250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101470250
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101470250
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 Ig_2 ig V-set Ig_5 NtA DUF4131 Ig_6 SIT C2-set DUF3169 EphA2_TM Neur_chan_memb
Other DBs
NCBI-GeneID: 101470250
NCBI-ProteinID: XP_004563248
LinkDB
Position
LG2
AA seq 712 aa
MRLDPVHFSMLVIGVSFACYAPSLNSLQDQAYRSAVVIEGEVRSSPENVSSREPYSVNVK
VLDVWPVNSGGLEREQLVTVGDFGSEAPCTTVEKDHRYIFFMDPTAEPLVFKASYAPVDA
SEPESKKDVERVLCEDCASAPKLRMISSQSLMEGKKLYLKCEASGNPSPSFRWYKDGHEL
QKGRDLKIKTNKKNSKVQISRVRVEDSGNYTCVAENSVGQENATSIISVQILTTTTLSPG
VSHARHCNDSEKSYCVNGGDCYFIHGINQLSCKCPNDYTGDRCQNSVMANFYKLLRIEFM
EAEELYQRRVLTITGICVALLVVGIVCVVAYCKTKKQRKKMQSHLHQNQNQCVEQPNRML
ANGPNHPGPGPEEIPMVDYISKSVPTTECVISHGAEGAGNYAGSRMSTRSHHSTTASHAS
RHEEHTWSMERTESMNSDCQSGGLSSSVGTSKCSSPACMARRAAHWGCTDASGPGMQYGD
SYDSLRDSPHSDRYVSALTTPARLSPVEFHYPPLPPQVPTFQITSPNTSHALSLPPAAAA
YHRDDDQPLLRCPDDGSLYRQPRRPRRPYLTESTGSLPSSPYRLPDDEAYETTQEYASSR
EPIRSRRRPRRNRLNGHISQRSAGLRDYSSQSFSQSEEEEEDEEEEDGHGESTPFLSMQN
MNMDPPLNVPGFRSSSGADTRTHRGLSRPGTRSNGQSRGSQSQRSKADNMPL
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgaggcttgatccagtgcatttctccatgctggtcatcggggtctccttcgcctgttac
gccccgagtctcaactccctccaggaccaggcgtacagatcagccgtggtcatcgagggc
gaggtgcgctcctccccggagaacgtctcctcccgggagccctacagcgtgaatgtcaag
gtgctggatgtgtggcccgtcaacagcggcggcctcgagagggagcagctcgtgaccgtc
ggggacttcggttccgaggccccgtgcaccacggtggagaaggaccacagatatatcttt
ttcatggaccccaccgccgagcccttggtattcaaggcatcgtacgcccccgtggacgcc
agcgagccggagtcgaagaaggatgttgagagagtgttgtgcgaggactgcgcctctgct
cctaagttgcggatgattagcagccaatctctgatggaagggaagaagctgtacttgaag
tgtgaggcgtcggggaatcccagcccttccttccgctggtacaaagatggacacgagctt
cagaaaggcagagacctcaaaataaaaaccaacaaaaaaaactcaaaggtgcagatcagt
cgtgtccgtgtggaagattctggcaactacacttgtgtggctgaaaactcagtaggacaa
gaaaacgccacaagtataatcagcgtgcagatcttgaccaccacaaccctgtctccaggt
gtgagtcatgcgcggcactgcaatgactctgagaagtcctactgcgtcaacggaggagac
tgttacttcatacatggtattaaccagctgtcctgcaagtgtcccaatgactatacgggg
gaccgctgtcaaaactccgtcatggccaatttctacaagcttctcagaattgaatttatg
gaggctgaggagctctaccagaggcgggtgctgacgatcacaggcatctgtgtggcgttg
ttagtggttggcatcgtttgtgtggtggcctactgcaaaacaaagaagcagaggaagaag
atgcagagtcacctacaccaaaaccagaatcagtgtgtggagcagccaaaccgcatgttg
gctaatgggccaaatcatcctggccctggtcctgaggagatccccatggttgactacatc
tccaagagcgtccctacgaccgagtgcgtgatcagccacggagccgagggtgcaggcaac
tatgcaggcagtcgaatgtcgacccgctcccaccactctaccactgcctcacatgcctcc
agacacgaggagcacacgtggagcatggagcgaacagagagtatgaactcagactgccag
tcaggtgggctctccagctctgtgggaaccagtaagtgcagcagcccagcatgcatggcg
aggagggccgcccactggggctgtacggatgcgtcgggaccgggaatgcagtacggggac
tcctacgattctctaagagactcacctcacagtgacaggtatgtgtctgcactgaccacg
ccagcacgcctgtctcctgtggagttccactaccccccgctgcctccccaggttcccact
tttcagatcacctcgcccaacacaagccacgccctctcccttccacctgctgctgccgcc
taccacagagacgatgaccaaccgctgttacggtgccccgatgatggaagtttatacagg
cagccccgacgtcctcgacgaccctacctgacagagagcacaggaagtctaccgtccagc
ccctaccggctccccgatgacgaggcttatgagacgacacaggagtatgcctcttcacgg
gaacccatcagaagccggcgtcgcccgcgacgcaaccgactcaacggacatatctcacag
cgctcggcgggtttacgggactacagctcacagagcttcagccagtcagaagaggaggaa
gaggacgaggaggaagaggatggtcacggggagagcacgcctttcctcagtatgcagaac
atgaacatggacccgcctctaaatgtcccgggtttccgttcgtcatccggtgcagacaca
cggactcaccgcgggctgagtcggccagggacgcgcagcaacgggcagagccgcggctcc
cagtcgcagcgctccaaggctgacaacatgcccctttaa

KEGG   Maylandia zebra (zebra mbuna): 101480242
Entry
101480242         CDS       T02814                                 

Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform isoform X1
  KO
K05456  neuregulin 2
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101480242
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101480242
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101480242
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 Ig_2 ig V-set Saf_2TM C2-set_2 DUF4131
Other DBs
NCBI-GeneID: 101480242
NCBI-ProteinID: XP_004564102
LinkDB
Position
LG10
AA seq 709 aa
MRLDSVHLSMLVIGVSFACYSPSLNSLQDQAYKSAVVIEGKVQSTPVNVSAEPYRVNVKV
LDVWPLNSGGLEREQLVTVGEFGSEAPCTKVKKNHKYIFFMDPTDEPLVFKASFAPLDTS
GKNLKKDVGRILCEDCAAAPKLKPMKNPMIVDEGSKLTVRCEATGNPAPTYRWFKDGNEL
KKSKKVKIRSGKKNSRVQISRAKLEDSGNYTCVVENLLGKDNSTGTVNVQSMTTTLSPGS
GHARKCNDTERAYCVNGGDCYFFHGINQLSCKCPNDFTGDRCQTYVMASFYQHLGIEFME
AEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRNRMHNHLRQNMCPEHPNRNLANG
PNHPGPGPEDIPMVDYISKNVPATERVIRPATEGSFPASHASSRSHNSSTRAHSSTHRHE
ERTWSLEHSDSILSDSPGMMSSSVGTSKCSSPACMEARARRAAHCGYSDPHRPRLQYGDS
FDSLGDSPHSDRYVSALTTPARLSPVDFHYSLPPQVPTFQITSPNASHAMSLPPAVHNPY
PLEDDQPLLRRYQVPLHDAHCQEPYRQQRRTYLNDSRGSLPSSPYRLAEDEDYETTQEYL
SSREQPKRSGSSGTGSRRWRRSRLNGHVAPRGYEASRDYGSRSCLTDSESEEDGESTPFL
SMQNMNAEPSTIYRPADSRTSNSSGRHSGHGNTHTRLTQSRSKPDNTPH
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgaggcttgattcagtacatttatccatgctggtcatcggggtctcattcgcctgctac
tccccgagtttgaattccctgcaggaccaggcttacaaatccgccgtggtgatcgagggc
aaggtgcagtctacgcctgtgaacgtctctgcggagccgtaccgtgtgaatgtcaaagtg
ctggatgtttggcccctaaacagcgggggtctggagcgagaacagctcgtcaccgtgggg
gaatttggatctgaggctccgtgcaccaaagtgaagaaaaaccacaagtacatttttttc
atggaccccactgacgagcccttggtttttaaggcatcgttcgcgcctcttgacaccagt
ggaaagaacctaaaaaaggatgttggaaggatcttgtgtgaggactgcgctgcggctcca
aagttaaaaccgatgaaaaatccaatgatagtggacgagggaagcaagctcacagttagg
tgcgaggccacaggaaaccctgcccctacctacagatggttcaaagatggcaacgagctg
aagaaaagcaaaaaagtcaaaataaggagcggcaagaaaaactccagagtccagatcagc
agagcaaaactggaggattctgggaattacacatgtgtggtggagaacctgctgggaaag
gacaactccactggcactgttaacgtccaaagcatgaccacaacgctatctccaggctca
ggccatgccagaaaatgcaacgacacagagagagcctactgtgtgaatggcggcgactgt
tacttcttccatggtataaatcagctttcctgcaagtgtccaaatgactttactggtgat
cgctgtcaaacctacgttatggccagtttctaccagcatcttgggattgaatttatggag
gcagaggaactctaccagaaaagagtcctgacaatcacgggtatttgtgtggctctcttg
gtcgtgggcatcgtgtgtgtggttgcctactgtaaaaccaagaaacaaagaaacaggatg
cacaatcatctgcgacaaaacatgtgtccagaacatcccaatcgtaacttagctaatgga
cccaatcacccaggacccggcccggaggatatccctatggtagattacatatcaaagaat
gtccctgcgactgaacgtgttatacggcctgctacagagggctcatttcctgccagtcat
gcctcttccagatctcacaactcttccacacgagctcattcatcaactcacagacatgag
gaacggacatggagcctggaacattctgacagtatcctctctgactcgccgggaatgatg
tcatcatccgtggggaccagtaaatgcagcagccctgcgtgcatggaggctcgagcacgg
cgcgctgcacactgtggttactctgacccccatcggccgaggctgcagtacggggactcc
ttcgactcgctgggagactctccgcacagcgacagatacgtatcagccctgacaacacca
gcccgcctatccccagtggatttccattactcattgcccccgcaggtgcctaccttccag
atcacatcccccaatgccagccacgccatgtcgctccctcctgctgttcacaatccgtac
cccctggaggatgaccagcctctgctgcgccgctaccaggtgcccctacacgatgctcat
tgccaggagccttaccggcagcagcgtcgaacctatctaaatgacagcaggggaagcctt
ccctccagcccctaccggctggctgaggatgaagactatgagaccacccaggagtatctg
tcctctcgggagcaaccaaagagaagtgggtccagtggaactggaagccggcgctggcgg
agatccagactgaatggccacgtggccccacgaggatacgaggcatctcgggactatggg
tctcgaagctgtctaacagatagtgagtcagaggaggacggcgagagcacgcccttcctc
agtatgcagaacatgaacgccgagccttccaccatctacaggccggcggacagtcggact
tctaactcgtcagggcgacacagtgggcatgggaacacgcatacgagactcacacagtca
cgctccaaaccggacaatacaccgcattaa

DBGET integrated database retrieval system