KEGG   Maylandia zebra (zebra mbuna): 101470362Help
Entry
101470362         CDS       T02814                                 

Gene name
metap1d
Definition
(RefSeq) methionine aminopeptidase 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mze01002]
    101470362 (metap1d)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     101470362 (metap1d)
Peptidases [BR:mze01002]
 Metallo Peptidases
  Family M24
   101470362 (metap1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 101470362
NCBI-ProteinID: XP_004542504
LinkDB All DBs
Position
LG18
AA seq 339 aa AA seqDB search
MAARCSAGLAISSGVASFLRRAYVGSCSSPTALLCQQHRRFFWRKWKRSHNVVRPATVRP
AYAVPKHIVQPNYVQTGLVPEWPDYIEIKDKEQIEGLTRACQLARHVLLLAGRSLKVGMT
TEEIDFIVHKETIKHNAYPSPLRYGGFPKSVCTSVNNVVCHGIPDSRPLEDGDIINIDVT
VYLDGYHGDTSETFLIGQVDEVGRRLVETARRCRDEAINACKPGAQLCVIGNTISEIAHA
SGFQVCPYFIGHGIGSHFHCHPEIWHHANDNDMTMDEGMAFTIEPILMEGSAEFRILKDK
WTAVSVDDKRSAQFEHTVVITADGVDILTKLPEESSASN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgctgttcagcaggacttgcaatatcgtcaggagtggccagttttctgcgc
agagcttatgtgggcagctgtagttcccccacagccttgctgtgtcagcagcatcgacgt
ttcttctggaggaagtggaaacgttctcacaatgtagttcgtccagctactgtcaggcct
gcctatgcagtacccaagcatattgtgcagcctaactatgtgcagactggacttgtccca
gaatggccagactacatagaaatcaaagacaaagagcagatcgaaggcctgactagagca
tgtcagctggccagacatgtgctgctcctagctgggcgcagtctgaaagttggtatgaca
acagaagaaatagacttcatcgtgcacaaagagacaatcaagcacaatgcctacccgtcc
cctctcagatacgggggtttccccaaatcagtctgtacatctgtgaacaacgtggtctgt
catggcatacctgacagtcggccacttgaagatggagatatcatcaacattgatgtaact
gtgtatttggatggttaccatggtgacacctcagaaaccttcttgattggtcaggttgac
gaggttgggaggcgactggtggaaaccgccaggcgttgcagagatgaagccatcaatgcc
tgcaaaccaggtgcacagctttgtgttattggaaatactatcagtgaaatagcccatgcc
agtggcttccaagtgtgtccgtatttcattgggcatggaataggctcccattttcattgc
catcctgagatttggcaccacgctaacgacaatgacatgaccatggatgaagggatggct
ttcacgatagagcctatcctgatggaggggtctgcagagttcagaatcttgaaggacaag
tggactgcagtttctgtagatgataaaaggtcagctcagtttgagcacacagtggttatc
acagcggacggtgtggatattctcaccaaactgccagaagagagcagtgcatcaaactga

DBGET integrated database retrieval system