KEGG   Maylandia zebra (zebra mbuna): 101470533Help
Entry
101470533         CDS       T02814                                 

Definition
(RefSeq) trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101470533
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mze01002]
    101470533
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101470533
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101470533
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101470533
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101470533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101470533
NCBI-ProteinID: XP_004560050
LinkDB All DBs
Position
LG11
AA seq 245 aa AA seqDB search
MKYFILLALFAAAYAAPIDDDKIIGGYECTKNSVPYMVSLNVGYHFCGGSLISSSWVVSA
AHCYQSSIQLRLGEHNIAVNEGTEQFISSSRVIRHQSYNSYNLDNDIMLIKLSTPATLNS
YVKTVSLPSGCASAGTSCLISGWGNTSTSGSNYPDRLMCLNAPILSDTDCRNSYPGEITN
NMFCAGFLEGGKDSCQGDSGGPVVCNGRLQGIVSWGYGCAQRNRPGVYTKVCNYNSWINN
TMANN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttcattctccttgccctgtttgctgcagcatatgctgctcccattgacgat
gacaagatcattggaggctatgagtgcacaaagaactctgtgccctacatggtttctctg
aacgttggctatcacttctgtggaggctccctgatctccagctcctgggtcgtgtctgct
gctcactgctaccagtcaagcatccagttgcgccttggtgagcacaacattgctgtcaat
gagggcactgagcagttcatcagctcttccagggtcattcgtcaccaaagctacaacagc
tacaacctggataacgacatcatgctgatcaagctgagcacccccgccaccctgaacagc
tacgtcaagaccgtgtccctgccctctggctgtgccagtgccggcacctcctgtctgatc
tctggatggggcaacaccagcaccagtggaagcaactaccctgaccgtctgatgtgcctg
aatgcccccatcctgagtgacacagactgcaggaactcctatcctggagagatcaccaac
aacatgttctgtgctggattccttgagggaggcaaggactcctgccagggtgactccggt
ggccccgtcgtgtgcaatggccggctgcagggtattgtgtcctggggttacggctgtgct
cagaggaacaggcctggagtctacaccaaggtctgcaactacaacagctggatcaacaac
accatggctaacaactaa

DBGET integrated database retrieval system