KEGG   Maylandia zebra (zebra mbuna): 101470576
Entry
101470576         CDS       T02814                                 

Gene name
plcg1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04370  VEGF signaling pathway
Module
mze_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101470576 (plcg1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101470576 (plcg1)
   04370 VEGF signaling pathway
    101470576 (plcg1)
   04020 Calcium signaling pathway
    101470576 (plcg1)
   04070 Phosphatidylinositol signaling system
    101470576 (plcg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101470576 (plcg1)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101470576 (plcg1)
Membrane trafficking [BR:mze04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101470576 (plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101470576 (plcg1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 PH C2 SH3_9 SH3_2 PH_12 GDPD EF-hand_like DUF812 Mcp5_PH
Other DBs
NCBI-GeneID: 101470576
NCBI-ProteinID: XP_004546027
UniProt: A0A3P9DLD6
LinkDB
Position
LG20
AA seq 1311 aa
MAGTSGFFSNGPVPWMDNATEMNNLYRDLELGTVLTLFYSKKSQRPERRTFQVKLETRTI
IWTRGTDKIEGEIDIREIKEIRSGQKSRDFDRYVEDSAARLDQAHCFVILYGTEFRLKSL
SLAATSDEEMTMWVQGLTSLVTDTLKSPTPLQIERWLRKQFYAVDRNREDRISCKDLKSM
LSQVNYRVPNMRFLREKLPDSEMRNGDVSFSQFAQLYRSLMFDAQKNMEIPFLQRFIDRP
EQRISLEDFKSFLLESQKEMWATDNNKVQEFMFGYLKDPLREVEQPYFQQDEFLTYLFSK
ENTIWDSSLDQVCPENMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIE
LDCWDGPEGMPVIYHGHTLTTKIKFSDVLTTIKEHAFVTSEYPIILSIEDHCSIVQQRNM
ATHFKKVFGDMLLTKAVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVSTTTPYSEND
ISNSIKNGILYLEDPINHEWYPHFFVLTSSKIYYSEETSSNPGNDDEEEHREVSYGMDQH
VTEKWFHGKLGAGRDGRQIAERLLSEYCLETGAPDGSFLVRESETFVGDYTLSFWRSGRV
QHCRIHSRQEAGSPKFYLTDNLVFDTLFALITHYQQVALRCNEFEMKLTEPVPQTNAHES
KEWYHANLSRSHAENMLMRVPRDGAFLVRKRAEPNSFAISFRAEGKIKHCRVQQEGQTVV
LGTSEFDSLVDLISYYEKHPLYRKMKLRYPINEDTLEKIGTAEPDYGSLYEGRNPGFYVE
ANQMPTFKCTVRAMYEYKAQRDDELSFTKNAIISNVEKQEGGWWKGDCGGKKQMWFPANY
VEEISPSAAEPDRTEMTENSPLGDMLRGSLDVSACQINVRTEGKGSRPYVFTLTQNTPVR
IGIPLDIAANTQEELKEWVFKIREVTLTSEAKIEEGKMMERRKKIALELSDLVIYCRPVP
FDEEKIGTERACFRDMSSFPETKAEKYVNKIKGKKFLQYNRLQLSRIYPRGQRLDSSNYD
PLPMWLCGSQLVALNFQTGDKPMQMNQALFMLNGRSGYVLQPPIMRDDNFDPFDRQTLRG
VEQVSLEIEVLGSRHLPKHGRGIVCPLIEIEVCGAEYDSAKQKTDSEADNGLNPTWPRKT
FQFTVCNSAFAFLRFVVYEIDMFNDQNFLAQATFPIHGLKTGYRSVPLTNSYNEDLELAS
LLVHMDITRGRDENGEVLSPFAAVGASSVSATAQSVRERFGELSSVSSTSSSMSPLPQSP
AQAMAYRGREGSFESRYQSPIDDFRVSQETLLDMDAQNRRIPRRTRVENRV
NT seq 3936 nt   +upstreamnt  +downstreamnt
atggctgggacctctggcttcttttccaatggacctgtgccgtggatggacaacgccaca
gagatgaacaacctgtaccgagacctggagctggggacagtactgacactattttattct
aagaagtcccagcggccagagagaaggacatttcaagtaaagctggagaccaggactatt
atctggactcggggcacggataaaatagagggcgagattgatattcgagaaatcaaggag
atccgttctggacagaaatctcgggactttgatcgctatgtggaggactctgcagcacgg
ctcgatcaggcccactgctttgttattctgtacggcacagagtttcgccttaaatcactc
agcctggcagcaacatctgatgaagagatgaccatgtgggtgcaagggttaacctcgctt
gtgactgacacattgaagtctccaacacctcttcagatcgagcggtggttacgtaagcag
ttctacgcagtcgatcgcaacagagaagacaggatatcctgtaaggatctgaagagcatg
ctgagccaggtcaactacagggtgcccaacatgaggttcctccgagagaaacttccggac
tcggagatgaggaatggagacgtgtccttcagccagtttgcgcagctttatcgtagtctc
atgtttgatgcccagaaaaacatggaaatcccatttcttcaaaggttcattgatagacca
gaacagaggatttccctggaggacttcaagagcttcctcttggagtctcaaaaggagatg
tgggccacagataacaacaaagtgcaagagtttatgttcggctacctgaaagaccccctg
agggaagtggagcagccttatttccagcaagacgagttcctcacatacctgttctccaaa
gagaacaccatctgggattcctccctggaccaagtgtgtcctgagaatatgaacaacccc
ctgtctcactactggatctcctcttcgcacaacacctacctgacaggagaccagttttcc
agtgaatcgtccttggaggcatacgcacgctgtctgaggatgggctgtcgctgtattgaa
ttggactgctgggatggccctgagggaatgccagtcatctaccatgggcacacccttaca
accaaaatcaagttttctgatgtcttgaccaccatcaaagagcacgcctttgtcacatct
gaatatcccatcatcctgtccatagaggaccactgtagtattgtgcagcagaggaatatg
gccactcactttaagaaggtgtttggagacatgcttctaaccaaggcagtggatatcgca
gcagatgggctgccctcacccaatcagctcaagaggaagatcctcatcaagcataagaag
ctcgcagaaggcagtgcctatgaggaggtgtccaccaccactccctactcagagaatgat
atcagcaactccattaaaaatggcatcctgtacctggaagatcccattaaccatgagtgg
taccctcatttttttgttctgaccagcagtaagatctactactcagaagagacctccagt
aacccgggaaacgatgatgaggaggagcacagagaggtgtcctatggtatggatcaacat
gtgacagagaaatggtttcatggaaagcttggtgctgggcgggatggacggcagatagcc
gagaggctgctgtctgagtactgcctggagactggagctcctgatggctccttcctagtt
cgggagagcgagacttttgtcggagactacaccttgtctttctggcgctcggggcgggtg
cagcactgtcgcatccactctcgtcaggaggcaggcagcccaaagttctacctgactgac
aacctggtatttgacacgctctttgctctgattacccactaccagcaggtggcgctgcgc
tgtaacgaatttgagatgaagctgactgagccggtacctcagaccaatgctcacgagagc
aaagagtggtaccacgccaacctctccaggagccatgcagagaacatgttgatgagggtt
cctcgcgatggggcttttctagtcaggaaaagggcagagcccaactcctttgccatttca
ttcagagccgagggtaaaataaagcactgtcgtgtgcagcaggagggtcagaccgtggtg
ctgggcacctcagagtttgacagccttgtagatcttattagctactatgagaagcaccct
ttgtaccgtaaaatgaaactacgctatcccatcaacgaggacacactggagaagataggc
actgctgagccagactacgggtcactgtatgagggaaggaatccaggcttttatgtggag
gctaatcaaatgccaacatttaagtgcacggtgcgagccatgtatgagtataaagcccag
agagacgatgagctttccttcactaagaatgctatcatctctaatgtggaaaaacaggaa
gggggatggtggaagggtgactgtggaggaaagaagcagatgtggtttccggcaaactac
gtggaggagatcagtccgtcagcagccgagcctgatagaactgagatgacagaaaacagt
cctcttggagatatgctgagaggaagtcttgatgtgtctgcctgtcagattaatgttcgt
accgaagggaaaggcagcaggccttatgttttcaccctgacacagaatacccctgtgcgg
ataggcataccgctcgacatcgctgcaaacacgcaagaagagctcaaggaatgggtgttc
aagatccgtgaggtcaccttgacctcagaggccaagatagaagaggggaagatgatggaa
aggaggaagaagattgcactggaattatctgaccttgtcatctactgtaggcctgtgcca
tttgatgaagaaaagattggcacagagcgagcctgtttccgggacatgtcatccttccct
gaaaccaaggcagagaaatacgtcaacaaaatcaaggggaagaagttcctgcagtacaat
cggctgcagctgtccaggatctaccccagaggccagagattggactcttctaactatgac
ccgctccccatgtggctctgcggatctcagctggtagcacttaacttccagacaggagac
aagcccatgcagatgaaccaggccctgttcatgctgaacggaagaagtggctacgtcctt
cagccgcccatcatgagggacgacaactttgatccctttgacagacaaacactacggggt
gtggagcaagtcagtctagagattgaggtcttgggctcccggcatctgcccaagcatgga
cgtggcatcgtttgccctctgattgagatcgaggtgtgcggagcggagtacgacagcgcc
aagcaaaaaacagactctgaagctgataatggtctcaatcccacttggccgagaaagaca
ttccagttcaccgtgtgcaactctgcttttgcctttctgcgttttgtggtgtatgagatc
gacatgttcaacgaccaaaacttcctggctcaggctacgttccccattcatgggctaaag
acaggttaccggtcagtacctctgacgaacagctacaacgaggacctggagttagcttct
ctgttagtccacatggacataaccagaggaagggatgaaaacggtgaggttctcagccca
ttcgctgcagtcggggcctcatcagtgtcggcaacagctcagtcagtgcgggagcgtttt
ggggagctgagctcagtctcctcaacgtcgtccagcatgtctcctttgcctcagtctcca
gcccaggccatggcctacagagggagggaaggctcttttgaatcccgctaccagtccccc
atagatgacttcagggtgtcccaggagacactgctggacatggacgcgcaaaacagaagg
atcccgcggaggaccagagtggagaaccgtgtctaa

KEGG   Maylandia zebra (zebra mbuna): 101473405
Entry
101473405         CDS       T02814                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04370  VEGF signaling pathway
Module
mze_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101473405
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101473405
   04370 VEGF signaling pathway
    101473405
   04020 Calcium signaling pathway
    101473405
   04070 Phosphatidylinositol signaling system
    101473405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101473405
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101473405
Membrane trafficking [BR:mze04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101473405
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101473405
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 EF-hand_6 EF-hand_9 GDPD
Other DBs
NCBI-GeneID: 101473405
NCBI-ProteinID: XP_004572376
UniProt: A0A3P9CMA2
LinkDB
Position
LG17
AA seq 1312 aa
MCAARFSGCLNGCAEEAPSSVAGAAGSVMVSRMLDWSEAGARILHSLEMGTVMTIFYQKK
SQRPERRTFQIRQDTRQIVWSRNPDKIEGEIDIREIRELRLGKGSRDFERYPEEARKLDS
THCFIVLYGLEFRLRTLSVAAFSEEEVNMWITGLNWLMMDTQRAPAPQQIDRWLRKQFEV
MDRSHEGSITVKDVKALLPQVNYRVPNMRFLKDKLQEVEARSDLSYPNFAQLYRTLMFDA
QRSIIEQLELSFPLRNVDRPELCQISLYDFQKFLQMDQKESWASDLGRVREFLMGYMRGA
PQPEPMLQLDEFLTFLYSKENSVCDPRLSPVVPDDMKRPLSQYWISSSHNTYLTGDQFSS
ESSLEAYARCLRMGCRCIELDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIKEHAFVISE
YPVILSIEDHCSVVQQRNMATHFKKVFGDLLLTKPVDNNAEELPSPYQLRRKILIKHKKL
VEGTLYEEVTSASYSENDISNSLKNGILYLEDPIDHTWTPHYFVLTSNKIYYSEETSHYQ
TADEEEDDEGKEECNNNEQHCAERWFHGKLGGGRDGRQVAEKLLQEYCEGGAKDGTFLVR
ESETFVGDYTLSFWRSGRVQHCRIHSRQESGSTRFYLTDNLVFDSLYRLICHYRDTPLRC
NEFEMRLGNPVPQPNAHESREWYHSNLSRVQAEHMLMRVPRDGAFLVRKRSEHNSYAISF
RAEGKIKHCRIQQEGRLFMLGSSAEFESLVDLVSYYEKHPLYRKMRLRYPINEDTLDRMG
TTELDYGALYEVRTPHFYVEANKMPTARCTVKALYDYRAQREDELCFPKQALILNVDKQE
GGWWRGDYGGKKQLWFPANYVEEVPSSPTREMDEASTENSPLGTFLKGFIDVPTCHLVVH
KDGKNSRAFVFTIHSQHLSSHPVQTLDVAADSLEDLTGWVSKIREAAQNADARMQEEKQM
ERRKKIAVELSDLVVYCRPVPFNEDKIGTERACYRDMSSFPETKAEKFATRGRGKRFLQY
NRRQLSRIYPRGQRLDSSNYDPLPMWLCGSQLVALNFQTPDKPMQLNQALFMLGGGSGYV
PQPDIMRDDMFDPFDKDTLHVEPITIQLQVLGARHLPKNGRSIVCPFVELEICGADYDSY
KCKTDVVADNGLNPVWVQKQFVFDIHNPTFAFLRFTVYEEDMFSDPNFLAQATYPVRLLK
TGYRSVPLKNSYSEELELASLLVHIEIVNAKEEDDENLYTSIQRLRDRTCELSNQVSLLE
RSGSADLSYQQSLEELRAAQDQLSELVEARNRRLMEKKRREKLRQQVIAKRS
NT seq 3939 nt   +upstreamnt  +downstreamnt
atgtgtgcagccagattcagtggctgcctcaatggctgtgctgaggaggcccccagtagt
gttgcaggggctgctggttcagtcatggtctccaggatgctggactggtctgaggcaggt
gcccgcatcctccacagcctggaaatgggcacagtgatgaccatcttctatcagaaaaag
tctcagcgccctgagaggagaacgttccagataaggcaggacacgaggcagatagtgtgg
agcagaaacccagacaaaatagaaggagagatcgacatacgggagatccgggagctgcgg
ttggggaagggctcccgtgattttgagcgctaccctgaggaggctcgtaagctggactcc
acccactgctttatagtgctgtacggcctggagtttcgcctccggaccctcagtgtagct
gccttcagtgaagaggaagtcaacatgtggatcactggactcaactggctaatgatggac
acgcagagggcaccggcaccacaacagattgacaggtggctgaggaaacagtttgaagtc
atggacaggagccacgagggcagcattacagtaaaggatgtgaaagctctgctgcctcag
gtcaactatcgagtgcccaacatgcgctttctcaaagacaagctacaggaggtggaggcc
aggagcgacctgtcataccccaactttgcacagctctacagaacactgatgtttgatgca
cagaggagtattattgagcagctggagctctccttccctctgcgaaatgttgacagacca
gagctatgtcaaatctccctctatgactttcaaaagtttttacagatggaccagaaggag
tcctgggcgtcagatcttggtcgtgtcagggagtttcttatgggctacatgaggggggca
ccacagcctgagccgatgctacaactggatgagttcctgaccttcctgtactctaaagag
aattctgtgtgtgaccctcgtctttcacccgtagttcctgatgacatgaaaaggccattg
tctcagtactggatctcatcttcgcacaacacgtacctgacaggtgaccagttttccagt
gaatcatctctagaagcctacgctcgctgtctgaggatgggctgccgctgcattgaactg
gactgctgggatggacctgatgacctgccaatcatctaccacggccacacattaacttcc
aagatcaaattcctggatgtgctgcataccatcaaagaacatgcctttgttatatctgag
tatcctgtgatcttatccatcgaggaccactgcagtgtggtccagcagaggaacatggcc
acgcacttcaagaaagttttcggagatctgctgctcaccaaaccggttgacaataacgca
gaggagcttccttcgccctaccagctccgcaggaagatcctcatcaaacacaagaagctg
gttgaaggaaccctgtatgaagaggtgacgtcagccagctactctgaaaacgacatcagt
aactccctaaagaacggcatcctttacctcgaagaccccattgaccatacatggacgcca
cattattttgtcttgaccagtaataagatttactactctgaggagacgtctcattatcag
acagctgatgaagaggaggatgatgaaggaaaggaggagtgcaacaacaatgagcagcac
tgtgcagagcgctggtttcatgggaagctgggtggaggacgcgatggccgacaggtggct
gagaaactcctgcaggagtactgcgagggcggggccaaagacggcaccttcctggtccgg
gagagtgagacatttgttggagactacaccctctccttctggcgctctggtcgggtccag
cactgcaggatacattcacgtcaagagtctggctccacccgcttctacctgactgataac
ctggtgtttgacagcctctaccggctcatctgccactatagagacacgccgctccgctgc
aacgagtttgagatgaggctgggaaaccctgtacctcagccgaatgcacacgaaagccga
gagtggtaccactccaacctgtcccgtgttcaggctgaacacatgctgatgcgtgtgccc
agagacggagctttcctggttcgaaaacgcagtgaacacaactcctacgccatctccttc
agggcagagggtaagatcaaacactgccgtatccagcaagaaggccgtctcttcatgttg
ggtagctcggcagagtttgagagtctggtggatctggtgagctactatgagaaacatcct
ctgtatcgtaaaatgaggctccgctaccccatcaatgaagacactctggaccggatgggc
accacggagcttgactatggagcgctgtatgaagttcgcactcctcatttctatgtggag
gctaataagatgcccacagcacggtgtacggtcaaagctctgtatgactatcgagctcag
agagaagacgagctatgtttccccaaacaagcgctcatcctgaatgtggataagcaggag
ggcggctggtggagaggtgactatggaggaaagaagcagctgtggttccctgcaaactat
gtagaggaggtccctagttcccccactagagagatggatgaagcatccacagagaacagt
cctctgggaactttcctcaaaggcttcatagatgtaccaacctgccacctggtggtgcat
aaagacggaaagaattcccgggcctttgtgttcactatccactcccaacacctctcttct
catccggtccagactctggacgtagcagctgacagtctggaagatctcaccggctgggtc
agcaagatcagagaggctgcacagaatgctgatgcacgaatgcaggaggagaaacagatg
gagaggaggaagaagattgcagtggagctgtctgacctcgtggtctactgcagaccagtg
cccttcaatgaggacaagattgggacggagcgagcatgttaccgggatatgtcctccttc
ccggagacaaaggcagaaaagtttgcgacccgtggccgagggaaacgctttctgcagtac
aaccgtcgtcagctttccaggatttatcccagaggacagaggctggactcctccaactat
gaccctctacctatgtggctctgcggctcacagctggttgcactcaatttccagacccca
gataaacccatgcagctgaaccaagctttgttcatgcttggaggtgggagtggctatgtt
ccccagcctgacatcatgagggatgacatgtttgaccctttcgacaaggacacattgcac
gtggagccaatcaccatccaattacaggtgctgggagctcgccatctgcctaagaatggt
cggagcattgtctgtccttttgtagagttggaaatctgtggagccgactatgacagctac
aagtgcaagacagatgttgtagctgataatggtctgaatcctgtgtgggtgcagaagcag
tttgtgtttgatatccacaaccctaccttcgcctttctgcgcttcactgtctacgaggag
gacatgttcagcgatcccaacttcctggcacaggcaacctacccagtccgtctgctcaaa
acaggctacaggagtgtacctctaaagaacagctacagtgaggagctcgagctagcgtcc
cttctggttcacatagaaatcgtcaatgctaaggaggaagacgatgagaacttgtacaca
tccatccagcggttgcgagatcgaacctgcgagctgtccaaccaggtttctctcctggag
aggtcaggctccgcagacctgagctatcagcaaagtctggaggagctccgagccgctcag
gaccagctgagtgagctggtggaggctcgcaaccgcaggctgatggagaagaagagaagg
gagaagctgagacaacaggtgatagcaaagcgcagctaa

KEGG   Maylandia zebra (zebra mbuna): 101479429
Entry
101479429         CDS       T02814                                 

Gene name
plcg2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04370  VEGF signaling pathway
mze04625  C-type lectin receptor signaling pathway
Module
mze_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101479429 (plcg2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101479429 (plcg2)
   04370 VEGF signaling pathway
    101479429 (plcg2)
   04020 Calcium signaling pathway
    101479429 (plcg2)
   04070 Phosphatidylinositol signaling system
    101479429 (plcg2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101479429 (plcg2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101479429 (plcg2)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101479429 (plcg2)
Membrane trafficking [BR:mze04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101479429 (plcg2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101479429 (plcg2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14
Other DBs
NCBI-GeneID: 101479429
NCBI-ProteinID: XP_004573947
UniProt: A0A3P9AQW8
LinkDB
Position
LG7
AA seq 1249 aa
MARLGQQGEMTEYRKIVIKRDLEMGVVMTVFRQKAERLTVQVIMETRQVAWTRTADKTDG
VLDLSEIREIRPGRNSKDFERFKDGKDKRDESTCFTIFYGSQFVLSTLSLGADSVDEAQK
WLVGLEMLREETRASPTPVLIESWLRKQMYSVNQTKTNSISLKELKALLPLMNYKAPSSR
TLKEKFQEVGSKKDRLDFEQFHKFYNLLMFEQNEILDEFKKESCAFILGNTDKPDASAVL
LHDFQRFLIYQQQETWANDLNQVRELMTTFIDDTMRKTNDPEFTVSEFLGFLFSKENCIW
DEKFSDISNVDMNNPLSHYWVNSSHNTYLTGDQIRSESSTEAYVRCLRLGCRCVELDCWE
GPGEPIIYHGWSRTTKIKFEDVVRAINEHAFVTSEFPVILSIEEHCPVDQQRQMARTFRE
VFGDKLLIEPVEHLAEQLPSPTQLKGKIILKHKKINMEGGFTVKDVRKGQKEGDLEIWDP
VDQRWNKHYCVISDDKLYYAEEYEDEEEDPRKYQDLHCSEPWFHGRMKEGRQMAERLIQD
YCKETSGRDGTFLVRQSDTFVTDYTLSFWRSGRVQHCRIRSVTEGGHTSFYMTANLHFPS
VYALIQHYRDNPLRCQDFELRLTDAVPKPDSHLQEGWFYSNLSRGQAEDYLMRIPRDGAF
LIRQREGEPDSFAITFRGDGKVKHCRIQKEGNMYLLGTTTEFESLVELVNYFRKKPLYRK
IKLRYPVTPELVDRFSTEKNCASLYDVKTYVEPNEIEPSLPKNTVKALYSYQARRPDELS
FQQGALIHNVSKEADGWCRGDHGGKLQLFFPANYVEPVSSNTEPVIRVQEMEDNPLGELC
QGVVDISKCNIQNLKNGKYGKPHAVTLQDQDEDSLQFDLTAGSLEELFEWYKVAWDIIQR
TANQQYSKDQQMKQQVEVEKKAVVATEMSEVVVYCQPRSKEKDRFDSYSYKEVRSFVENK
LPGKSRTKDFLQYNRKALSRIYPKGQRVESSNYDPYPMWALGCHMVALNFQTADKYMQLN
NALFSLNGQTGYVLQPEFMRMDSYDPHQDKKEVKYKIVVKVIGARHLPKPGRSIASPFVE
IELCGHTEEKYKTIVYRDNGLNPVWKGSERIILSVYEPELTFLRFIVNEEDMFSDPNFLA
QATFPVKGLRSGYRSVPLKNGYSEDLELASLLVYISVQQAGKAEEELYSSSSQLKKKQAE
LGEPFLYDTHSNLQRSSLAQPTNNLMRKGSTGENPRSKEKKINNSKFYS
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggctcgtttggggcagcagggcgagatgactgagtacaggaagatcgtgatcaagcgg
gacctggagatgggcgtggtcatgacggtgtttcggcagaaggcagagcgcctcactgtg
caggtcatcatggagacccgtcaggtggcgtggacacgtaccgcggacaagaccgatggc
gtcttggacctgtctgagatccgggagatccgtccgggaaggaactccaaggactttgaa
cgcttcaaagatgggaaggacaagcgcgatgagagcacctgcttcaccatcttttacggc
tcccagtttgttctcagcaccctcagtctgggagctgattctgtggatgaggcgcagaaa
tggctggtgggacttgaaatgctgagggaggagactcgggcatcaccaaccccggtgctc
atagagagctggctgaggaagcagatgtattctgttaatcagaccaagacaaacagcatc
tccttgaaggaactgaaggcactgcttcctttgatgaactacaaggcgccgagctctcgc
actttgaaagaaaagttccaggaagtgggctcgaagaaggatcgcctggactttgagcag
tttcataaattttacaaccttctcatgtttgagcagaatgagattcttgacgagttcaag
aaagaatcctgcgccttcattctgggtaacacagacaaaccggatgcttcggccgttctc
ctgcacgatttccaacgatttctcatctatcagcaacaggaaacttgggccaatgatctg
aaccaagtcagagagctgatgacaacctttattgatgacaccatgagaaaaaccaatgac
ccggagttcaccgtgagcgagttcctcggcttcctgttttccaaggagaattgtatttgg
gatgagaagttctcagacatcagcaacgtggacatgaacaaccctttgtcgcattactgg
gtcaactcctcacacaacacctacctgacaggtgatcagattcgcagcgagtcgtccaca
gaggcttatgtccgctgtctgcgtctgggatgccgctgcgtcgaattggactgctgggag
ggccccggggagccaatcatttaccatggctggagcaggacgacgaagatcaagtttgag
gatgtggtcagagcgataaacgagcacgcttttgtcacctcagagttcccggtgattctg
tccatagaggagcactgccctgtagatcagcagcgtcagatggctcgtactttcagagaa
gtatttggagacaaactgctgatcgaacccgtggagcacctggccgagcagctgccttca
cccacgcagctgaagggcaagatcatactcaagcacaagaagatcaacatggagggagga
ttcaccgtcaaggatgttagaaagggacagaaagaaggagacctggagatctgggaccct
gtggatcagcgctggaacaagcactactgtgtgatctctgacgacaagctgtactatgca
gaagagtacgaggatgaggaagaggatcccaggaagtatcaggaccttcactgctcggag
ccgtggttccacggtcgcatgaaggaaggcaggcagatggccgagcggctgatccaagat
tactgcaaagagaccagcggacgagacggcaccttcttggtccgacagagcgataccttc
gttacagactatacgctctccttctggcgaagcgggagggtgcagcactgtcgcattcgc
tccgtcacagagggcggacacacctccttctacatgacggcaaacctgcactttcccagc
gtgtacgccctgatccagcactacagagacaacccactgcgctgccaggactttgagctg
cgcctcaccgatgccgtaccaaaacccgactcacatctgcaagaagggtggttctacagt
aacctgagcagaggtcaggcagaggattacctaatgaggattcccagagatggagccttt
ctcatccggcagagagaaggagaaccagactcctttgccatcacattcagaggtgacggt
aaggtgaaacactgccgcatccagaaggagggcaacatgtatctgctgggcaccactacg
gagttcgagagcctcgtggagctggtcaactactttaggaagaaaccgctgtatcgcaag
attaagctacgttacccggtcacgcccgagctggtcgaccgcttcagcacagagaagaac
tgtgcctctttatatgatgtgaagacgtatgtggagcccaatgagatcgagccctcgctg
cctaaaaatactgtcaaggcattatacagctaccaggcgaggaggccagatgagctgagc
tttcaacaaggagctttgatacacaacgtgtccaaagaggctgatggatggtgcagagga
gaccacggtggcaagttacagttattctttcctgctaactatgtggagccagtgtccagc
aacaccgaacctgtcatcagagtgcaggaaatggaagataacccactaggtgaactatgt
cagggcgtcgtggacatctccaaatgcaacattcaaaacttgaagaatggtaaatacggg
aagccccacgcagtgaccttgcaggaccaggatgaagacagtctgcagtttgacttgact
gcaggttctctggaagagctgtttgaatggtacaaggtggcatgggacattattcagaga
acggcgaaccagcagtacagcaaggatcaacagatgaaacaacaggtggaagtggagaag
aaggcagtggtcgccacggagatgtcggaggtggtggtctactgtcagccacgcagcaaa
gagaaggaccgctttgacagttacagctacaaggaggtccgctccttcgtggagaacaag
cttccagggaagagccgcaccaaagacttcctgcagtacaaccgcaaagctctgagtcgt
atctacccgaaaggccagcgcgtcgagtcctcaaactacgacccttacccgatgtgggcc
ctcggctgtcacatggtggctctcaacttccaaacagcagataaatacatgcagctgaac
aacgccctcttcagtctgaacggacaaacgggctacgtgctgcagccggagttcatgcgt
atggatagctacgaccctcatcaggacaagaaggaagtcaaatacaaaattgtggtcaag
gtgattggtgccaggcaccttccgaagccaggccgcagcatcgccagtccatttgtggag
atcgagctgtgcgggcacacagaggagaagtacaagaccatcgtctatcgtgacaatggt
ctgaacccagtgtggaaaggctcagagcgcataatcttgagtgtgtatgagcctgaactc
accttcctgcgcttcatcgtcaacgaggaggacatgttctcagaccccaactttctagct
caggccacgtttcctgtgaaaggccttcgctcaggttaccgctctgtccctctgaagaac
ggctacagtgaagacttggagctagcttctcttctggtctacatcagtgtgcagcaggcc
gggaaagcggaggaggagctgtactcgtcttccagccagctgaagaagaagcaggcagag
ctgggcgaacccttcctgtacgacacacacagcaaccttcagcgatcctccctggctcag
cccaccaacaacctcatgaggaagggcagcactggtgaaaatccaaggtcaaaagaaaag
aagataaacaacagtaaattttactcctga

DBGET integrated database retrieval system