KEGG   Maylandia zebra (zebra mbuna): 101470685
Entry
101470685         CDS       T02814                                 

Gene name
raf1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04270  Vascular smooth muscle contraction
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04916  Melanogenesis
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101470685 (raf1)
   04012 ErbB signaling pathway
    101470685 (raf1)
   04370 VEGF signaling pathway
    101470685 (raf1)
   04371 Apelin signaling pathway
    101470685 (raf1)
   04068 FoxO signaling pathway
    101470685 (raf1)
   04150 mTOR signaling pathway
    101470685 (raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101470685 (raf1)
  09143 Cell growth and death
   04210 Apoptosis
    101470685 (raf1)
   04218 Cellular senescence
    101470685 (raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101470685 (raf1)
   04540 Gap junction
    101470685 (raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101470685 (raf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101470685 (raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101470685 (raf1)
   04912 GnRH signaling pathway
    101470685 (raf1)
   04914 Progesterone-mediated oocyte maturation
    101470685 (raf1)
   04916 Melanogenesis
    101470685 (raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101470685 (raf1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101470685 (raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101470685 (raf1)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101470685 (raf1)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101470685 (raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 zf-RING_2 zf-C3HC4_2
Other DBs
NCBI-GeneID: 101470685
NCBI-ProteinID: XP_004546231
UniProt: A0A3P9DKF7
LinkDB
Position
LG20
AA seq 672 aa
MAHPQGVWKSLSNGFGMKDSPFEGPCLSPTIVQGYPCQRRSSDDSKMPDSKASSTIRVYL
PNQQRTVVNVRPGMTLYHCLIKALRVRGLQPQCCAVFRLNSGQGSRKSRMDWNTDSTSLI
GEELQVEVLDHVPLTTHNFVRKTYLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPT
MCVDWINIRQLLLCQTPGECNAPSVPPPSSRRMRESLTRLPSSAYRYSTPHAFNYAPPTG
GGLSQRQRSTSTPNVHMVSTTLPVDSSVIELDCLNTSPSSWCHRFWLKRKVGIVHFSQSF
VEASPESPEKDAMRDHDSAGSSPNQSPTGWTQSQSKTPAPAQRERAPSLNTQDKIKIRPR
DKRDSSYYWEIEASEVYLHSRIGSGSFGTVFKGKWHGDVAVKILKVTDPTPEQFQAFRNE
VAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHIHVLETNFKMIQLIDIARQTA
QGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWSGSHQVEQPSGSILWMA
PEVIRMEDNNPYSFQSDVYSYGIVLFELMTGELPYSQIGNRDQIIFMVGRGYLSPDLSKL
YKNCPKAMKRLVADCTKKSKDERPLFPQILSSIELLQHALPKINRSASEPSLHRATHTED
INACTLTRVPVF
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcgcaccctcagggagtgtggaagagcctgagcaacggttttggaatgaaggactct
ccgtttgagggcccctgcctttctccgaccatagtccagggctatccctgccagcgtcgc
tcctcagatgacagcaagatgcccgactcaaaggctagcagcactatccgtgtctacctc
ccgaaccagcaacgcactgtggtaaacgtgcgaccaggtatgactctttaccactgcctg
attaaagcactgagggtgcggggcctgcagcctcagtgctgcgctgtcttcaggctgaat
tcaggacaggggagtagaaaatcacggatggattggaataccgattccacttcactaatt
ggggaagagctgcaggtggaggttttagatcacgtccccttgacaacgcataattttgtt
cgcaaaacatatctgaaactagcgttctgcgatatttgccagaagttccttctgaatggt
ttccgttgccaaacatgtggctacaaattccatgagcattgtagcaccaaagtgcccaca
atgtgtgtggactggatcaatatcaggcaactcttattgtgtcaaacgcccggcgagtgc
aatgccccgtctgtgccaccgccttcgtcccggcgtatgagagagtctttaacgcggctt
ccaagctcagcctaccgttattccacccctcatgccttcaactacgcaccacccactggt
ggcggtctctcccagaggcagcgctccacttctacaccaaatgtccacatggttagcact
actctgcctgtagacagcagcgtgatcgagctagactgcctgaatacctcccccagctcc
tggtgccatagattctggctgaagaggaaagtaggtattgtgcacttctcccagtctttt
gttgaggcctcacctgagagtccagaaaaggatgcaatgcgtgatcatgactcggcgggg
agttcacccaaccagagtcctacaggctggacccaatcccaatccaaaacccctgcacct
gcccagcgagagagggccccatccctcaacactcaggacaaaattaaaataaggcctcgg
gataagcgtgactccagttactactgggagattgaggccagcgaggtttatctgcactcc
cgcattggttccggctccttcggaactgtattcaaaggaaaatggcatggtgatgtagca
gtaaagattttaaaggtgacagaccctacaccagagcagttccaggcattcagaaatgaa
gtggcagtcctcaggaaaacacgacatgtcaacatcctgttgttcatgggttatatgact
aaggacaacctggccattgtgacacagtggtgtgagggtagcagcctctacaagcacata
catgtcctggagacaaatttcaagatgatccagctcatagatattgccaggcagactgct
cagggcatggactatcttcatgcaaagaacatcattcaccgagacatgaaatcaaacaac
attttcttgcatgaagggctaacagtaaaaattggcgactttggtcttgctacggtgaaa
gcaaggtggagtggctcacatcaggtcgagcagccttctggatccattctttggatggct
cctgaggttatccggatggaggataataatccttacagcttccagtctgatgtctattcc
tatggaattgttctctttgagctcatgacgggagagctcccatactcccagataggaaat
agagatcagattatcttcatggtgggaagaggctatctatctccagacctcagcaagctc
tataaaaactgccccaaagccatgaaaaggttggtggctgactgcaccaagaagtccaag
gatgagaggccactctttccacagatcttgtcctccattgagcttctccagcatgccctc
cctaagataaaccgcagtgcctcagaaccgtccctgcacagagccactcacactgaggat
attaatgcctgtactctgaccagagtgcctgttttttag

KEGG   Maylandia zebra (zebra mbuna): 101471760
Entry
101471760         CDS       T02814                                 

Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04270  Vascular smooth muscle contraction
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101471760
   04012 ErbB signaling pathway
    101471760
   04068 FoxO signaling pathway
    101471760
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101471760
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101471760
   04914 Progesterone-mediated oocyte maturation
    101471760
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101471760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101471760
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101471760
Protein kinases [BR:mze01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101471760
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH RA TUG-UBL1 Kdo C1_2
Other DBs
NCBI-GeneID: 101471760
NCBI-ProteinID: XP_004574268
UniProt: A0A3P9B5E9
LinkDB
Position
LG12
AA seq 611 aa
MSSTSSSYSSSGETSPEDPPRGGGTIRVYLPNKQRTVVNVRQGQTVHEILDKALKVRGLS
QECCAVFRLLGGRKRLTDWDTDITPLVGEELLVEVLDDIPLTMHNFVRKTFFKLAYCDFC
HKFLFNGFRCQTCGYKFHQHCSSKVPTVCVDMDTIRERSDPSPCPDGYPQIILPENSPTQ
SNPALTPEPSGMGHLSPSPSSTFHFPMSGGDGQSLQRHRSTSTPNVHMVSTLDPASAMII
EEALKFNNTIGPEPSPKPSTSPPSSFGSPGKKPPKSPSEPRERKPSSSDDKKKVHRGGNR
DSSYYWEVHSREVNIQKRIGSGSFGTVFKGKWHGDVAIKILKVKEPTPEQLQAFKNEMQV
LRKTRHVNILLFMGFMTKPNFAIITQWCEGSSLYRHLHVLESKFDTVRRIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGWTVKIGDFGLATVKARWTGSQQVEQPSGSILWMAPEV
IRMQDTNPYTFQSDVYGYGVVLFELMSGTLPYSNINNRDQIIFMVGRGYLSPDLSKLYST
SPKAMKRLIVDCLKFKRDERPLFPQILVSIEQVQDLLPKIERSRSEPSLHRAVHAEDLNP
LLFHTTRLMPL
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgtcctccacctcctcctcctactcctcctcaggggagaccagtccagaggatccaccc
cgaggtggaggaaccatccgagtctacctccccaacaaacagaggacagtggtgaatgtc
cgccaaggacagactgtgcatgagattctagataaagcgctcaaagtgagaggcctgagc
caagagtgctgtgctgtatttcgccttctaggaggtcgaaaaagactgacggactgggac
acagacataactcctctagttggagaggagcttttagttgaggtcctggatgatattccc
ctgaccatgcacaactttgtacgcaaaactttcttcaagctggcttactgtgatttttgc
cacaagttccttttcaatggcttcagatgtcagacatgtggctacaagtttcaccaacac
tgcagtagcaaggtccccaccgtgtgtgtggacatggatactataagagagcgttctgat
cccagtccttgcccagatggatacccacagataatactgccagaaaattcccccacgcag
agcaacccagccttaaccccagagccttctggaatgggccacctgtccccatccccgtcc
tcaacctttcacttccccatgtcaggcggagatggtcagtctctacagaggcatcgctcc
acatctactcccaatgttcatatggtcagcacattggaccctgcttctgccatgattata
gaggaagcactaaagttcaacaacacaataggtcctgaaccctcacctaagccctccacc
agcccgccctcttcttttggctctccagggaagaagccaccaaagtccccttcggaaccc
agggagcgcaagccctcgtcctctgatgacaaaaagaaagtgcaccgaggaggcaacaga
gattcaagttactactgggaggtccactctcgagaagtcaacatccagaagagaataggt
tctggctcctttggaactgtcttcaagggaaagtggcatggagatgtggcaatcaagatc
ctcaaagtcaaagagccaacgcctgagcagttacaagcctttaaaaatgaaatgcaggtg
ttgcggaagacccgccacgtcaacatcctgctgttcatgggcttcatgactaagcccaac
tttgccatcatcacacaatggtgtgaaggcagcagcctgtaccgccatctgcatgtctta
gagagcaagtttgatactgtgcgtcgcattgatgtggccagacagacagcacagggcatg
gattatcttcatgcaaagaacataattcatcgagatctaaaatcaaacaatatttttctc
catgagggctggactgttaaaatcggtgactttggcttggctacagtgaaggctcgatgg
actggctctcagcaggtagaacaacccagcggatccattctctggatggctcctgaggtg
atccgcatgcaggacacaaacccatacacgttccagtcagacgtatatggctacggagta
gttctgtttgagctgatgtcaggaaccctgccttactccaatatcaacaacagagaccag
ataatcttcatggttggacgtggttacctgtctccagacctcagtaagctgtatagtacc
tcacccaaagcaatgaagaggctgatcgtcgactgcctgaagtttaaacgtgatgaaagg
cccctttttccacagattctggtgtccattgagcaggtgcaagatttgctgccgaaaatc
gagcggagtcgctccgagccgtcgctccatcgagctgtccatgctgaggacctgaacccc
ctcctgttccacaccaccaggctcatgcccctctaa

KEGG   Maylandia zebra (zebra mbuna): 101476445
Entry
101476445         CDS       T02814                                 

Gene name
braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04150  mTOR signaling pathway
mze04270  Vascular smooth muscle contraction
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101476445 (braf)
   04012 ErbB signaling pathway
    101476445 (braf)
   04068 FoxO signaling pathway
    101476445 (braf)
   04150 mTOR signaling pathway
    101476445 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101476445 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101476445 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101476445 (braf)
   04914 Progesterone-mediated oocyte maturation
    101476445 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101476445 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101476445 (braf)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101476445 (braf)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101476445 (braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101476445
NCBI-ProteinID: XP_004553800
UniProt: A0A3P9BSY0
LinkDB
Position
Unknown
AA seq 822 aa
MAALSSAESPPPVFNGDTTELEPGRERGLDELGAGLDSSCSSGIPGGPQDEEIWNIKQMI
KLTQEHLEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAIGNSADFSCSQS
AIPALLEVKIGGCGVGAGPQAFHSAPNTLAVLQTPTDTSRANPRSPQKPIVRVFLPNKQR
TVVPARCGMTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEV
LENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQL
DLLLVSKFFEHHPFTQEEVSSEGTTPVSEACPSLPPSDSTGSICHATVSPSKSIPIPPSF
RPNEEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLPRSDGAPPTHPACCLRKH
RTRTSSPLLYSYPNDIVFDFEPEPVFRGSTTGLSATPPASLPGSLTNVKVPQKSPCPQRE
RKSSSSSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGSGSFGTVFKGKWHGDVAVKML
NVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQLAIVTQWCEGSSLYHHLHIIE
TKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWS
GSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIVLYELMSGALPYSNINNRDQI
IFMVGRGYLSPDLSKVRSNCPKAMKRLMADCLKKKREERPLFPQILASIELLARSLPKIH
RSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFSAFK
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggcggcgttgagcagcgccgagtccccaccgcccgtctttaacggagacactacggag
ctggagccgggcagggagcggggcctggacgagctgggcgccggactggactcgtcctgc
tcgtcggggatcccgggaggtccgcaggatgaggagatctggaacatcaaacagatgata
aagttaacacaagaacatctggaggctctcctggacaagtttggcggagaacacaaccct
ccctccatttatctagaggcctatgaggagtacaccagcaaactggacgctctgcagcag
agggagcagcagctgctggaggccatcgggaacagcgcagacttctcctgctctcagtct
gctataccagcccttctggaagtcaagataggaggttgtggggttggtgcagggcctcag
gctttccactcggccccaaacactttggctgtcctgcagacccccactgacacaagccga
gccaaccctcgctccccccagaaacccattgtcagggtcttcctgcccaacaaacagcga
acagtggtgccggcacgctgtgggatgactgtgagggactccctgaagaaagccttgatg
atgcgaggactcattccagagtgctgtgcagtctataggatacaggatggagagaagaag
cctattggctgggacacagacatctcgtggctgacgggggaggagctgcatgtagaagtg
ttggaaaacgtgccgctcaccacacacaactttgtgaggaagactttctttacactggcc
ttctgtgacttctgcagaaagttgttgttccagggtttccgctgtcagacctgtggctac
aagttccaccagcggtgcagcactgaggttcctctcatgtgcgtcaactacgaccagctc
gacttgctactagtgtccaagttctttgagcaccacccgttcacccaggaggaggtctcc
tcagagggaaccacgcctgtgtctgaggcctgtccatcacttcccccatccgactccact
ggatcaatatgccacgccactgtgtcaccgtccaaatccatacccatcccgcccagtttc
cggcccaacgaggaggaccaccgcaaccagtttggccagcgggaccgttcatcctctgcc
cccaatgtgcacatcaacaccatcgaaccggtcaacatcgatgacctgattcgagatcag
ggcttaccgaggtcagatggagcccccccgacccaccccgcctgctgcttgaggaagcac
cgaacacggacctcaagccccctcctatactcctatcccaatgacatagtgtttgatttt
gagcccgagcccgttttccgaggttcgaccacaggtctgtcggccacacctcccgcctct
ctgcctggctctctgaccaacgtcaaggtcccacagaagtcgccgtgcccgcagagggag
cgcaaatcgtcctcctcgtccgaggaccgcaataagatgaaaaccctggggaggcgggac
tccagtgatgactgggaaatcccggaaggtcagattactctgggtcagaggataggctct
ggatcttttggaactgtcttcaagggaaagtggcacggtgatgtggcagtgaagatgctg
aatgtcaccgctcccacgccacagcagcttcaggcattcaagaatgaagtgggagtcctc
aggaaaacgcgtcacgtgaacatcttgctcttcatgggctacaccaccaagccccagctg
gccatcgtgacccagtggtgtgaaggctccagtctgtaccaccacctgcacatcatcgag
accaagttcgagatgatcaaactgatcgacatagcccgacagaccgctcagggcatggat
tacctgcatgccaagtccatcatacacagagatctgaagagcaacaatattttcctccat
gaggacctaacagtgaagatcggggactttggtctggctacggtgaagtcccgctggagt
ggctcccaccagtttgaacagctttcaggctctattctttggatggctccagaggtaatc
cggctgcaggacaagaacccctacagcttccagtcggacgtgtacgcctttggcatcgta
ctctacgagctgatgtcaggagcgctgccctactccaacatcaacaacagagaccagatc
atattcatggtgggacgaggttacctgtcccctgacctcagcaaggtccgcagcaactgt
ccaaaggccatgaagaggctgatggctgactgcctgaagaagaagagagaggagcggcct
ctcttccctcagattttggcatccattgagctgctggctcgctcgttacccaaaatccac
cgcagcgcctcggagccttcgttaaaccgagctggttttcagacagaggacttcagtttg
tatgcctgcgcctcacctaaaacccccatccaggccggcggttacggggagttttcagca
tttaaataa

DBGET integrated database retrieval system