KEGG   Maylandia zebra (zebra mbuna): 101471030
Entry
101471030         CDS       T02814                                 

Gene name
sos2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04150  mTOR signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101471030 (sos2)
   04012 ErbB signaling pathway
    101471030 (sos2)
   04068 FoxO signaling pathway
    101471030 (sos2)
   04150 mTOR signaling pathway
    101471030 (sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101471030 (sos2)
   04540 Gap junction
    101471030 (sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101471030 (sos2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101471030 (sos2)
   04912 GnRH signaling pathway
    101471030 (sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101471030 (sos2)
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101471030 (sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH Spectrin_like
Other DBs
NCBI-GeneID: 101471030
NCBI-ProteinID: XP_004540087
LinkDB
Position
LG19
AA seq 1331 aa
MQPQQIYDFSSDENSHKWRGLFVQALRKVQKQVHPNLTAKEDALQYIEELILQLLNMLCV
AQPRTVQDVDERVQKTFPHPIDKWAIADAQSAIEKRRRRHPLLLPVDKIHPLLKEVLGYK
VDYHVSLYIVAVLEYISADILKLAGNYVGNIRHFEITQQDIKVSMCADKVLMDMFDQEED
IGLMSQCAEEPLSSGELTYDDLVRLEIAEERQYLRELDLIVKVFRRHFLHSKVFTNEDVE
VVFSNILDIHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDIL
GGEFHSHFNSLMARPTVGLYFQSVTEGFKEAVQYILPQLMMVPVYHCMHYFELLQQLQER
SEDLDDRECLKQALTALLNLQSSMERIYAKHQPRRKPGEPMYRLYSRQIRSKQLAIKRMN
EIQKSIDGWEGKDIGQCCSEFILEGPLIRAGAKHERHNFLFDGLMISCKANQSSRLPGAG
SGAEFRLKEKFVLRKVSITDREDSPELRNAFELVAKDDTRAVFCARTAEEKEAWMAALVT
LQYRSTLDRMLDTELQQEEQAQPLRLPSPEVYRFAVQDSEENIVFEDKVQSKTGIPIIKA
GTVDKLIERLTYHMYADPNFVRTFLTTYRSFCKPHEFLTLLIDRLTIPDPEPTDEDRQIL
MTNDHPMVAQLQRFRKEYVQPVQLRVLNVFRQWVEHHFYDFENDAELRSRLEEYFTTKIQ
LRGKSMRKWVESINKIIRRKMQPQTNGVSPSITFESSPPSIEWHICRSGQLELFDLMTLH
PIEIARQLTLIESELYRAVRPSELVGSVWTKEDKEKHSPNLLRMIRHTTNLTLWFEKCIV
ETMNLEERVAVFTRVIEILQVFQELNNFNGVLEVLSAINSVAVYRLDHTYEAVPERKRKI
LEEAAELSKDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKDLINFSK
RRKVAEITGEIQQYQNQPYCLKVEPEMRKFFENLNPMGNLSEKEFTDYLFRKSLEIEPRN
CRQPPRFPRKTVYSLKSPGIRPVRTSTSGTLKGHPVPLERDPPHKITFRSINENDSESLV
SVPTSPNTPTPPQSATPDFNSVFTEHDQLSNSYGGSSNSIFAPVLLFTGKLQSASCGSLH
HLGEELKPPPLPPRRKDTMSDTKLSTRSDSPPAIPPRVPPPLHRNQPRPPVYNGPPTDGP
LPSPPPPPPPRDPIPDTPPPVPQRPPEIFINYPVNQPSPVGRYTWDYGSSPSSPNTPPST
PSPRIARRGCSLSASQNSLCPLSIPTSAPPVPPRYNSSPHLPKLPPKTYKRELLQAPVQS
LSLVENTDSSH
NT seq 3996 nt   +upstreamnt  +downstreamnt
atgcagccccagcagatatacgacttttcaagtgacgagaatagtcacaaatggagaggc
ctcttcgtgcaagctctacgaaaggtacagaagcaggtccacccaaacctgacagcaaag
gaggatgccctccagtatatcgaggagctgatcttgcagcttctcaacatgctgtgtgtg
gcccagcctcgcactgtgcaagatgtagacgaacgcgtccagaaaaccttcccccaccct
atagataagtgggcaattgcagatgcccagtcagccattgagaaacgcaggagaagacac
cccttactacttcctgtggataaaatacatccactgctcaaggaggttttgggctacaaa
gtggactaccatgtgtccctatacattgtggcagtgcttgaatacatatcagcagatata
ctgaaactggcaggaaactatgttggcaacattcggcactttgaaatcacccagcaggac
atcaaagtgtccatgtgtgcagacaaagtgttgatggacatgtttgaccaagaggaggat
attgggttgatgtcgcagtgtgcagaggagcccttgtcctcgggggagctcacgtatgat
gacctggtgaggcttgaaatcgcagaggagcggcagtacctgagagagctggacctcatt
gtcaaagtgttccgcagacacttccttcactccaaagttttcacaaacgaggatgtcgag
gtggttttcagtaacatcctagacatccacgagttgactgtgaagctgctcgggttgatt
gaggacgctgttgagatgactgctgatggcagccctcatccgttggtgggcagctgcttt
gaagatctggcggaggagcaggccttcgatccctacgagactttgtctcaagacatcctc
ggcggggaatttcattcacatttcaacagcttgatggcacgaccaacagttggcctctac
ttccagtcagttacagaaggctttaaagaagctgtgcaatatatccttccccagctgatg
atggtcccagtgtaccactgtatgcactactttgagctactgcagcaacttcaagagcgc
agtgaagacctagacgacagagaatgtctgaaacaggcgcttacagctctgcttaacctt
caatctagcatggagcgaatttatgccaaacaccagcctcgacgtaaacctggtgagcca
atgtatcgtctgtatagcaggcagattcgtagcaaacagctagccatcaaacgcatgaac
gagatccagaaaagcatcgacggctgggagggaaaagacatcggtcagtgctgcagcgag
ttcatcttggagggcccgcttatacgtgcaggtgctaaacacgagagacacaacttcctt
tttgatggcctgatgatcagctgtaaggccaatcagagttcacggctcccgggagcgggt
agcggggcggagttccgtctgaaagagaagtttgttctgaggaaggtcagcattacggac
cgcgaggactcgccagagctgcggaacgcctttgaactggtagccaaagatgatacccgt
gccgtattctgtgctcgtacagcagaggagaaggaagcgtggatggcagcgctggtgact
ctgcaataccggtctactttagatcgcatgttggacactgagctgcagcaagaggagcag
gcacagcctctaagactgccctctccagaggtgtaccgttttgcggtgcaggactctgag
gagaatatagtgtttgaggacaaagtgcagagcaaaacaggaatccccatcattaaagcc
ggcacagtggacaagctcatagagaggctcacataccatatgtatgctgatcccaatttc
gttcgcacatttcttaccacataccgatcattctgcaagccacacgagtttctcaccctg
ctgatagacaggcttacgattcctgatccagaaccaacagatgaagacagacagatactg
atgaccaatgatcatccgatggtagcccagctccaaaggttccgaaaggaatacgtacag
ccggtccaactcagggttctcaatgttttccgtcagtgggttgaacatcatttctacgac
tttgagaacgacgcagagcttagaagtcgactagaagaatacttcaccaccaaaattcaa
ctgcgaggtaagtccatgagaaagtgggtggagtccatcaataagatcatcaggagaaag
atgcagcctcagacaaacggcgtcagtcccagcatcacatttgagagctcgcctccttcc
atcgagtggcacatctgcagaagcggccaactggagttgtttgacctcatgacccttcac
cccatagagattgcacgtcagctgacactgatagagtctgagctgtacagagctgttcgg
ccctccgagctggtcggcagcgtctggaccaaagaggacaaagagaagcactctccaaac
ttgctccgcatgattcgccacactaccaaccttactctgtggtttgagaagtgtattgtg
gagacaatgaacctggaagagagggtggcggtgttcacacgggtcatagagattctgcag
gttttccaggagctcaataacttcaacggtgtgctggaggtgctcagtgctatcaactct
gttgcagtctacagacttgatcacacctatgaggcagtaccagagaggaaaaggaagatc
ctggaagaggcagcagaactgagcaaggaccattttaagaaatacttggctaaactcaag
tcgataaacccaccctgtgtgcctttctttggtatctatttaaccaacatactgaagacg
gaggaaggcaacccagacttcctgaaacgccacgggaaggatctgatcaacttcagcaag
aggaggaaagtggcggaaatcacaggagagatccagcagtatcagaaccagccctactgt
ctgaaagtggagcccgagatgaggaaatttttcgagaacctgaacccgatgggtaacctg
agcgagaaggagtttactgactacctgttcagaaagtctctggaaatagagcctcggaac
tgcaggcagcctcctcgatttcccaggaagaccgtgtacagtctgaaatccccgggtatc
cgccccgtgcgaacatctacctctggcaccctaaagggccaccctgtccccctggagagg
gaccccccacacaagatcaccttccggagtatcaatgagaacgattcggagtcgctggtt
tcggtgcccacctctccgaacacgcccactcccccacagtcggccactcctgactttaac
tcagttttcacagagcacgaccagctcagcaactcctacggcggtagtagcaactccata
tttgctccagttctcctgtttactggaaagttacagtctgcgtcatgtggtagcctccac
caccttggagaggagctaaagccaccacctctgccgcctcgaaggaaagacaccatgtcg
gacactaaactgagcaccaggtccgacagccctcctgccatccctccccgggtgccgcct
cctctgcacaggaaccagcctcgacccccagtctacaacggccctcccaccgatggcccc
ttgcccagccctccacctccaccaccaccccgcgaccccatcccagacacgcctcccccg
gtgccccagcgacccccggagatcttcatcaactaccctgtcaaccagccttcgcccgtg
ggccgatatacctgggattacggcagctcgcccagttccccaaacacgccacccagcaca
ccgtcccctcgcattgccaggcggggctgctctctcagcgccagccagaatagcctctgc
cctctctctattcccacctccgctccacctgtcccccctcgctacaactccagcccacac
ctccctaaactcccaccaaagacatacaaaagggagctgctacaggcgccagtacaaagc
ctctcgctggtggagaacaccgacagcagccactga

KEGG   Maylandia zebra (zebra mbuna): 101471853
Entry
101471853         CDS       T02814                                 

Gene name
sos1
Definition
(RefSeq) son of sevenless homolog 1
  KO
K03099  son of sevenless
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04150  mTOR signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101471853 (sos1)
   04012 ErbB signaling pathway
    101471853 (sos1)
   04068 FoxO signaling pathway
    101471853 (sos1)
   04150 mTOR signaling pathway
    101471853 (sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101471853 (sos1)
   04540 Gap junction
    101471853 (sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101471853 (sos1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101471853 (sos1)
   04912 GnRH signaling pathway
    101471853 (sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101471853 (sos1)
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101471853 (sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 101471853
NCBI-ProteinID: XP_024658598
LinkDB
Position
LG6
AA seq 1364 aa
MQAAQPQYDFFSEENGPKWRGLLVPSLEKVLNQVHPNLVSQQEALQYVEELILQLLSMLC
QAQPRTCQDVEERVQKSFPHPIDKWALSDAQSAIEKRRRRNPLALPVDKIHPLLKEVLGY
KIDHQVSVYMVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMNMFHQDE
EDISGFPLMDEEPSANEEQSYYELVKSFMADCRQYLRQLNLIIRVFREPFNSNSMLFSQH
DVESIFSRILDIHEVTVKLLGLIEDTVEMTGEGSPHPLVGSCFEDLAEELAFDPYETYAQ
DMLRSGFHEHFLSQVSKPGASFHLQSICEGFKEAVQYVLPRLLLTPVYHCLHLFEILKQL
EEKSQDDEDKECLKQAITALLNLQSSMERICSRSLAKRRLSESACRFYCHQMKGKHLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGPPRL
PGASSTAEYRLKEKFFMRKVQINDKDDKEGEYRHAFEIILKDGNSVVFAAKSAEEKNGWM
AALISLQYRSTLERMLDTAMLQEEKEEQMRLPGAEVYRFAEPDSEENVVFEENVQSKSGI
PIIKAGTVLKLIERLTFHMYADPNFVRTFLTTYRSFCKPRELLDLLIERFEIPEPKPADA
NQTEGGEQPPSAELKRFRKEFVQPVQLRVLNVCRHWVEHHFYDFERDPLLLSEMEDFIAS
VKGKAMKKWVESITKIIQRKKQVQVSVPSHSITFQNSPPPIEWHICKPGDTEHFDLMTLH
PIEIARQLTLLESDFYRAVQPSELVGSVWTKEDKEIHSPNLLRMIRHTTNLTLWFEKCIV
ETENLEERVAVFSRIIEILQVFQELNNFNGVLEVVSAMNSAPVYRLDHTFEQIPSRQRKI
LEDAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLHRHGKDLINFSK
RRKVAEITGEIQQYQTQPYCLRVEGDIRKFFENLNPMGDLSEKDFSDYLFHKSLEIEPRQ
LRSAPRFAKKYTYPLKSPGIRPTSARPGTMRHPTPLQNEPRKISYSRIPDSESEGTPASA
PNSPRTPLTPPPASAASAASSSTDVGSVFDSPQGPSSPFHSTCDSIFAVVSLPHGPRSSS
VSSMVSFSRASEDVPVPPPVPPRRRPESAPAESSPSKMVSKLDSPQPFHLVSPPVSSTPL
VTRHCHHHHLTAPPPCLHESPQLPSTPPAPPQGRPRCDLLPQAFFPPTSLAQLPFAPPPP
HCPPHPLSLLLSPHLQEITPAFSTPPPLPPLTLDGPLCLHVTVFQTPPKTYKRDSVGHAP
MLDTPSVRLDSLEFQRVQGQLIGQAVEETELTLQLIGSEESKNV
NT seq 4095 nt   +upstreamnt  +downstreamnt
atgcaggcggcgcagccgcagtacgacttcttcagcgaagagaacggtccgaaatggaga
ggcctgctggtgccctcactggaaaaggtactgaaccaggtgcatcctaacctggtgtcc
cagcaggaggcgctgcagtacgtggaggagctgatcctgcagctgctcagtatgctgtgt
caggctcagccgcgcacgtgccaggacgtcgaggagcgcgtgcagaagagttttcctcac
ccgatcgataagtgggcactcagtgatgctcagagtgccattgagaagaggaggaggagg
aacccgctggcgctgcctgttgataagatccatcccctgctcaaggaggtgctgggctat
aagatcgaccaccaggtgtccgtgtacatggtcgccgtcctggagtacatctctgcggac
atcctgaagctggcaggaaattacgtgaggaacattcgacactatgagatctcccagcag
gatatcaccgtggccatgtgtgccgacaaggtgttgatgaacatgtttcaccaggacgag
gaggacatcagcggcttcccgctaatggatgaggagccgtcagccaatgaggagcagagt
tactacgagctggtgaagagcttcatggcggactgtcggcagtacctgaggcagctcaac
ctgatcatcagggtgttcagggagcccttcaactccaactccatgctcttctcccagcac
gatgtggagagcatcttcagtcggatcctggatatccacgaggtgacggtgaagctgctc
ggtctgatcgaggacacggtggaaatgaccggcgagggaagtcctcatcctctggtgggg
agctgcttcgaggacctggctgaggagttggctttcgacccctatgagacgtacgctcag
gacatgctgcgctctggcttccatgaacacttcctcagtcaggtgtccaaacctggagct
tccttccacctgcagtccatctgcgagggctttaaagaggccgttcagtacgttctgccc
aggctgctgctcacacctgtttaccactgcctgcacctgttcgagatcctcaagcaactg
gaggagaagagtcaggatgacgaggataaagagtgtctgaaacaggccatcacggctctg
ctcaacctgcagagcagcatggagaggatctgctccaggagcctggccaagaggaggctc
agcgagtcggcgtgccgtttctactgccaccagatgaagggtaagcacctcgccatcaag
aagatgaacgagatccaaaagaacatcgacggctgggaggggaaggacatcggccagtgc
tgtaatgagttcatcatggagggtaccttgacccgcgtcggcgccaaacacgaacgccac
atcttcctgttcgacggcctgatgatctgctgcaagtctaatcatggcccgccgcggctg
cctggtgccagttctaccgcggagtaccgcctcaaagaaaagttcttcatgcgcaaagtt
cagatcaacgacaaagatgacaaggagggcgagtaccgccacgccttcgagatcatcctg
aaagatggcaacagtgtggtgtttgccgccaagtctgcagaggagaagaacggctggatg
gcggcgctgatctcgctgcagtaccgcagcacactggagcgcatgctggacaccgccatg
ctgcaggaggagaaggaggagcagatgagactcccgggcgccgaggtgtaccgttttgcc
gagcccgactccgaggagaacgtcgtgttcgaggagaacgtccagtccaagtccggcatt
cccatcatcaaggcggggactgtcctgaagctgatcgagagactcaccttccacatgtac
gcagatccaaacttcgtccggacttttctgaccacctacagatcattctgcaaacctcgg
gagctgctggacctgctcatagagaggtttgagatcccggagccaaagccggcggacgcc
aatcagacggagggaggagaacagccacccagcgctgaactcaaacgcttccggaaagag
tttgtccaacctgttcagctcagagtgttgaatgtttgtcgccactgggtcgaacatcac
ttctatgattttgagagagaccctctccttctgagcgagatggaggacttcattgcttca
gtcaaaggtaaggcgatgaagaagtgggtggagtcaatcaccaagatcatccagaggaag
aagcaggtccaggtgagcgtgccgagtcacagcatcaccttccagaattcccctcctccc
atcgaatggcacatctgcaaacccggagacactgagcacttcgaccttatgaccctgcac
cccatcgaaatcgcccgccagctcaccctgctcgagtccgacttttacagggcggtgcaa
ccgtctgagctggtcggtagcgtctggaccaaagaggacaaagagatccactcgcccaac
ctgttacggatgatccgacacaccaccaacctcaccctgtggtttgaaaagtgtatcgta
gagacggagaacctggaggaacgcgtcgctgtcttttcccggatcatcgaaatcctgcag
gtgtttcaggagctcaacaatttcaatggcgtcctagaggtcgtcagcgccatgaactct
gcacccgtgtacagactggatcacacctttgagcaaattccgagtcgtcagagaaaaatc
ctggaggacgctcatgagctcagcgaggaccactacaagaagtacctggctaaactgcgc
tccatcaaccccccctgcgtccccttctttggaatctacctgaccaacatcctgaaaacg
gaggagggaaaccccgacttcctgcacagacacggcaaagatctgatcaacttcagcaag
agacggaaagtggccgagatcaccggagagatccagcagtaccagacccagccgtactgt
ctgcgggtggagggtgacatcagaaagttcttcgagaacctgaacccaatgggcgacctg
tcggagaaggacttcagtgattatctcttccacaagtctctggagatcgaacctcgccag
ctccgatcggctcctcgatttgcgaagaagtacacctatcctctgaagtctccggggatc
cgacccacttcggcccgacccggcaccatgagacatccgacgccgctccagaacgagccc
aggaagatcagctacagccgcatcccggacagcgagtccgaggggacgccggcctctgcc
cccaactctccccgtacccccctgaccccgccccctgcctccgccgcctccgccgcctcc
agctccacagatgtgggcagcgtgtttgactcgccgcaaggacccagcagcccattccac
tccacctgcgacagcatctttgctgtggtgtctctgccgcacggcccacggtcctcttcg
gtctcctccatggtgagcttcagtcgggcctctgaggatgttcccgttcctcctcctgtt
cctccccgcagacgaccggagtcggctcctgctgagtcttccccctccaagatggtgtca
aagctggacagcccccagccattccacctcgtcagcccacctgtaagctccacccctctc
gttactcgtcactgtcatcatcaccacctgacagccccccctccctgcctccacgagagc
cctcagctcccctctacacctcctgccccccctcagggtcgtccccgctgtgacctcctg
cctcaggctttcttccccccaacatctctggcccaacttccatttgctccacccccacca
cattgtcctcctcaccccctctccctgctcctgtcaccccacctccaggaaattacccct
gccttctccacccctcccccactccctcccctcaccttggatggccccctgtgcctccac
gtcacagtgttccaaactcccccaaagacatacaagagggattctgttggacacgccccc
atgctggacacgccctctgtgcgattggacagcctggagttccagagggttcagggacag
ctgattggacaggctgtggaggagactgagttaacactacagctgattggatcagaagaa
agtaaaaatgtgtga

DBGET integrated database retrieval system