KEGG   Maylandia zebra (zebra mbuna): 101471223
Entry
101471223         CDS       T02814                                 

Definition
(RefSeq) proheparin-binding EGF-like growth factor isoform X1
  KO
K08523  heparin-binding EGF-like growth factor
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101471223
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101471223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mze00536]
    101471223
Glycosaminoglycan binding proteins [BR:mze00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101471223
SSDB
Motif
Pfam: EGF BioW EGF_2
Other DBs
NCBI-GeneID: 101471223
NCBI-ProteinID: XP_014267540
UniProt: A0A3P9BTN4
LinkDB
Position
LG2
AA seq 239 aa
MRIFAVALLLAHALVMSRLASGAAVDRYQSNKQQHTSVISLLDTTRDRRAEEEENRGVRA
TTADYSKDGEAEEYDDDYYYYEEYEDGTSGDYELQLPRVAMSSKPKDPSTILEAENTEGK
TTRGKGKKRGKGKGRKRNPCLKKYKDYCIHGTCTYLKDLREPSCVCHHNYSGDRCQFILL
PSQSREGYDRTTALAVVAVVLSSLCLTIIGLLLMLRFHKRGEYDVENEEKVKLGSASNH
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaggattttcgctgttgcgctgttgctggctcacgcgttggtgatgtccagactggcc
agcggtgctgcagtagaccgttaccagagcaacaagcagcagcacacctctgttatcagc
ctcctggacacaaccagagacaggagagcagaggaggaggagaaccggggcgtgagggcg
acaacagcagattacagcaaggatggcgaggcggaggagtacgatgatgactactactat
tatgaagagtatgaagatggcacatctggagactatgaactgcagctgccaagagttgcc
atgtcaagcaaacccaaagatccttctaccatcctggaagctgaaaacactgagggaaaa
acaacgagaggaaagggaaagaagaggggaaaaggaaagggaaggaagaggaatccttgc
ctgaagaagtacaaagattactgcattcacgggacctgcacttacctgaaagacctccgt
gaaccatcatgcgtgtgccaccataattactccggcgataggtgtcagtttatcctgctg
ccatcgcagtcccgagagggctacgaccgcaccacagctctggcggtggtggcggtggtg
ctgtcgtctctgtgcctcaccatcatcggacttttgttaatgctcaggtttcacaagcgg
ggagagtatgatgtagagaatgaggagaaggtgaagctagggtcagcatccaaccactga

DBGET integrated database retrieval system