KEGG   Maylandia zebra (zebra mbuna): 101471360
Entry
101471360         CDS       T02814                                 

Gene name
mtor
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04136  Autophagy - other
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04218  Cellular senescence
mze04371  Apelin signaling pathway
mze04910  Insulin signaling pathway
mze04920  Adipocytokine signaling pathway
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101471360 (mtor)
   04371 Apelin signaling pathway
    101471360 (mtor)
   04150 mTOR signaling pathway
    101471360 (mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101471360 (mtor)
   04136 Autophagy - other
    101471360 (mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    101471360 (mtor)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101471360 (mtor)
   04920 Adipocytokine signaling pathway
    101471360 (mtor)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101471360 (mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101471360 (mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101471360 (mtor)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101471360 (mtor)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101471360 (mtor)
Membrane trafficking [BR:mze04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    101471360 (mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 HEAT HEAT_EZ EPSP_synthase Nipped-B_C Coatomer_E
Other DBs
NCBI-GeneID: 101471360
NCBI-ProteinID: XP_004572826
UniProt: A0A3P9B8G4
LinkDB
Position
Unknown
AA seq 2516 aa
MVIISGTATVLQQFVSGLKSRNEDTRAKSAKDLQHYVTTELRELSQDEATTFYDELNHHI
FELVSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDPVVMEMASKAMG
HLSMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFF
DNIFYAVWDPKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTFEEAEKGFDETLAK
EKGMNRDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDKYCKELMGFGTKPR
HITPFTSFQSVQPQQSNALLGLLGYSTPQGFPSFGATPVPAKSSLVESRYCRELMEERFD
QVCRWVLKYRTSKNPLIQMTILNLLPRLAAFQPHTFTDQYLSDTMGYLLGCLKKEKERTA
AFQALGLLVVAVRTEIQPYLSKILEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRA
MGPSIQPDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPL
RHPGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLN
SEHKEIRMEAARTCSRLLTPSIHLISGHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYC
VLASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAFVMPFLRKML
IQILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGVVI
SVLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYVVE
PYRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVS
LSESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQAVT
FIFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDIFT
LIREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSTGRSVTIKL
LNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLQARKVALETLDRLTESLDFTDYASRII
HPIVRTLDTTPELRSTSMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDILICRI
VKGYTLAEEEEDPLIFQHRQVRGNQGDALVSGPVEAGPMKKLHVSTTALQKAWGAARKVS
KDDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQDE
LIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKA
LHYKELEFQKGPTPLILESLISINNKLQQPEAASGVLEYAMKHFGELEIQATWYEKLHEW
EDALVAYDKKIDMNKEDPELILGRMRCLEALGEWGQLHQQCCEEWTLVSEETQAKMARMA
AAAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELT
AMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRETWWERLQGCQRIVEDWQRI
LMVRSLVISPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTTHPHV
TYAYMKYMWKSGRKIDAFQHMQHFVQGVQQQAQHAVAAEDHQRKQELYKLMARCFLKLGE
WQLSLQGINESTIPKVLQYYSNSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKKK
LRHTSGASANSEASNSDSEVDSTDPSPVPSPGQKKVNEDLSKTLLLYTVPAVQGFFRSIS
LSRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRALV
GRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAMMVS
EELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQA
YGRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMC
RDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDLR
QDERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDY
REKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVW
FDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPE
KIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMD
TNTKGTKRSRTRTDSYTAGQSVEALEGIDLGETTHKKAGTTVPESIHSFIGDGLVQPEAL
NKKAIQIINRVRDKLTGRDFSNEETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7551 nt   +upstreamnt  +downstreamnt
atggtgatcatatcaggcacagccactgtgctgcagcagtttgtcagtggactgaagagt
cgaaatgaagacactcgagcaaaatctgccaaagacctgcagcactatgtgactacagaa
ctcagagagttaagccaagatgaagctactacgttctacgatgagttgaaccaccacata
tttgagctggtgtccagctctgatgtgaatgaaaagaaaggagggattcttgccatagtg
agtctaattggagttgaaggaggcaatgccaccaggatcagtcgattcgccaactacctc
cgcaacctgctcccttccagcgaccccgtggtgatggagatggcctctaaagctatgggc
cacctttctatggcgggggacacctttacggctgagtatgtggagtttgaagtgaagaga
gccctggagtggttgggagccgacagaaatgaagggagacgccatgctgcagttttggtg
ttgagggagctggctgtgagtgcacccaccttcttcttccagcaagtccagccgttcttt
gacaacatcttttacgcagtatgggatcctaagcaggccatccgagaaggtgctgtgtct
gccctgcgagcctgtctcatcctcaccactcagagagagacaaaggaaatgcagaaacca
cagtggtacaaacaaacctttgaagaggcagaaaaaggctttgatgagactttggccaaa
gagaaagggatgaatcgcgacgacagggtccacggcgctcttctgatcctgaatgagctg
gttcgcatcagcagcatggagggagagcgtatgcgcgaggagatggaggagatcacacag
cagcagctggtccacgataagtactgcaaggaactgatggggtttggaacaaagccccgc
cacatcacacccttcaccagcttccagtcggtgcagccgcagcagtccaacgccctcctg
ggcttgttgggctacagcacacctcaaggcttccccagctttggggccacaccggtacct
gccaagagctctctggtggagagtcgctactgccgtgagttgatggaggagcgatttgac
caggtgtgtcggtgggtgctgaaatacaggaccagcaaaaatcctctgatccagatgacc
atcctcaacctgcttccacgcttggctgccttccagccgcatacctttacagaccagtat
ttgtcagacactatgggctacctgctgggctgcctgaagaaggagaaggagaggacggca
gctttccaggctttggggctgctggttgtggctgtgaggacagaaatccagccgtacctc
tccaagatccttgagatcatcaaggctgccctgccacccaaggactttgcacacaagagg
cagaagaccatgcaggtggatgctacagtgtttacgtgtattagcatgctttctagagcc
atgggtcccagcatccagccagacatcaaagaactgcttgagcctatgcttgctgtgggc
ctcagtcctgcacttactgcagtgctgtacgatctgagccgtcaaatcccccagctgaag
aaagatatacaggatggtttgctgaagatgctctctttggtattgatgcacaagccattg
cgtcaccctggcatgcccaaaggcctggctcaccagctagcctcaccaagcctcactaac
attccagaggctagtgacgttggcagcatcaccctggccctgcgaaccctgggaagcttt
gaatttgaaggacattccctcacccagtttgtgcgccactgtgctgatcacttcttgaac
agcgaacacaaagaaatccgaatggaggcagctcggacttgctcacgcctgcttactccc
tccatccacctgatcagcggccatgttgtcagccagaccgctgtgcaggttgttgcagat
gttctcagcaagctgctagttgttggcatcactgatccagatccagatatccgatactgc
gtgctggcgtctcttgatgaacgctttgatgctcacctcgcccaggctgaaaacttgcag
gcgttgtttgttgctctgaatgatgaggtgtttgagatcagagagctggcaatctgcacg
atcggacgcctgagcagcatgaaccctgcctttgttatgcccttcctacgcaagatgctc
atccagatcttaacagaattggagcacagcggtgtcggcaggaacaaagagcagagtgct
cgaatgcttggtcacctggtctccaatgcgccccgacttatacgtccttatatggaaccc
atcctcaaggctctcatcctcaagcttaaagacccagaccctaacccaggagtagtcatt
agtgtccttgcaaccattggcgagttggctcaggtgagtggcctagagatgaggaagtgg
atggatgagcttttcccaattattatggacatgctgcaggactcatcatcactggccaag
cgacaggtggctctgtggacactgggccagcaagtagctagtacaggctatgtggtggag
ccctaccgcaagtacccgtcccttctagaggtgctgcttaacttcctcaagactgaacaa
aaccagggcatcaggagagaggctatacgtgttctggggcttcttggagccctggatccc
tacaaacacaaggtgaatatcggcatgatcgaccagtcccgagatgcctctgctgtcagc
ctctcagagtccaaatccagtcaggactcggctgactatagcaccagtgaaatgctggtg
aacatgggtaacctgcccctggatgagttttaccctgctgtggcaatcgtcactttgatg
cgcatcctgagagacccatcactctccaaccaccacactatggtagtccaggcggtcacc
ttcatcttcaaatctttgggcctaaagtgcgtccagttcctgcctcaggtcatgcccact
tttctcaatgtcatccgggtgtgtgatgccagtatccgagagttcctctttcagcagatg
ggaatggtcgtgtgctttgtgaagattcacatccgtccctatatggatgacatcttcacc
ctcatcagagaatactggacaccaaacaaccccatgcagaacaccatcatcctcctgatt
gagcagattgtggtggcgcttggtggagagttcaagctctatctccctcagctcattcca
cacatgctacgtgtcttcatgcatgacaacagcaccgggcgcagtgttaccatcaagcta
ctcaatgccatccagctatttggtgccaacctagatgactacctccacttgttgctgccc
cccattgtcaagctctttgatgcccctgatgtgcccctgcaggcgcgcaaggttgccttg
gagacactggaccgactgacagagtccctggacttcacagactacgcttcacgcattatc
cacccgatcgttcggacacttgacaccactccagagctgcgttccacttccatggacacc
ctgtcctcactcgtattccagttgggcaagaagtaccagatcttcatccccatggtgaat
aaagtgatgctaaagcacaggatcaaccaccagcgttacgacatactcatatgtcggatt
gtcaagggctatactctggcagaggaggaagaagaccctctaattttccagcatcgccag
gttcgtggtaaccaaggtgacgctttggtcagcggaccagtagaggcggggcctatgaag
aagctccacgtcagcactactgcactccagaaggcttggggagctgccaggaaggtgtcc
aaagatgattggctggagtggctgaggcgcttgagtgttgtcctgctcaaagagtcatcc
tccccagctctgcgctcgtgctggtcactggctcagacctacatccctcttgccagagac
ttgttcaatgcagctttcctctcatgttggtctgagctgagtgaggaccagcaggatgag
ctgatccgcagcattgagttggcactcacatctcaagacattgctgaggtcacacagact
ttgctcaacttggcagagttcatggagcacagcgataagggccctctgcccctcagagac
gataacggcattgtgctgctcggtgagagagctgccaaatgccgtgcctatgccaaggca
ctgcattacaaagagctggagtttcagaagggaccaaccccccttatcctggagtctctt
atcagcatcaacaataaactgcagcagccagaagcagcatctggggttctggaatatgcc
atgaaacattttggtgagctggaaatccaagccacctggtatgagaagctacatgagtgg
gaagatgccttggtagcatatgacaagaagatcgacatgaacaaagaggatccagagctc
atcctggggcgaatgcgctgcttagaggctctgggagaatggggccagttgcaccagcag
tgttgtgaagaatggacacttgtcagtgaagaaacgcaggccaagatggcgcgcatggct
gctgctgctgcctggggtctagggcactgggacagcatggaagagtacacgtgtatgatc
cctagagacacgcacgatggggctttttatagagcagtgctagcccttcatcaggacctc
ttctcattggcccaacagtgcattgacaaagcaagagacctcctggatgccgagctcact
gccatggcgggagagagctacagtcgagcctacggggccatggtgtcttgccagatgttg
tcagaactagaggaggtaatccagtataagctggtgccagagagaagggaaatcatcagg
gaaacatggtgggagaggcttcagggctgtcagcgcattgtagaggattggcagaggatc
ctaatggtcagatctctggtcatcagcccccacgaagacatgaggacctggttgaaatat
gccagtctttgtggcaagagcggacgcctggcactggcccataagaccctggtcctcctc
ctaggtgttgacccctccaagcaacttgatcacccattgcctacaacccaccctcacgtt
acctatgcttacatgaagtacatgtggaagagcggccgcaagatcgacgctttccagcac
atgcagcattttgtgcaaggagtgcaacagcaagctcaacacgccgttgcagctgaggac
catcagcggaagcaggagctctacaagctgatggccagatgtttcttgaagctgggggag
tggcagctcagtctgcagggcatcaatgagagcaccatccccaaagttctgcagtattac
agcaattcaactgagcatgaccgcaactggtacaaggcttggcacgcctgggctgtgatg
aattttgaggcagtgctgcactacaaacaccaaaaccaagggcgagatgaaaagaagaag
ctgcggcacaccagtggtgccagtgctaatagtgaagccagcaacagcgacagtgaggtt
gacagcactgatcccagtcctgtgccctcaccaggtcagaagaaggtcaatgaggacctc
tcaaagacgttgctcctgtacacagttcctgctgtgcaaggttttttccgctccatttcc
ctgtccagaggaaataacttgcaggacacgcttagggttttgactctgtggtttgattat
ggtcactggcccgaagtgaatgaagctctggtggaaggcatcaagaccattcaaatagac
acctggctgcaggtcatcccgcagcttatagctcgaatcgacacccctcgagccctggtg
ggccgtctgatccaccagctgctaaccgacattggacgatatcatccccaggctttgatc
tacccactgactgtggcttcaaagtccaccactaccgcccgccacaatgctgccaacaag
atcctgaagaacatgtgtgaacactgcaacaccttagttcagcaagctatgatggtgagt
gaggagctcatccgagtggccatcttgtggcatgagatgtggcacgagggccttgaagag
gcatcccgtctgtacttcggtgagcgcaacgtcaagggcatgtttgctgtactggaaccc
ctacatgccatgatggagaggggaccacagaccctcaaagagacctctttcaatcaggct
tatgggagggacctgatggaggcacaagactggtgcaggaagtacatgcgctctggaaat
gttaaagacctgactcaggcctgggacctctactaccacgtgttcagacgcatctccaag
cagctgccacagctgacctccctggagctgcaatatgtttctccgaagctgctgatgtgt
cgagacctggagcttgctgtacccggcacttatgaccccaaccagcctatcattcgcatc
cagtccatcgccccctccctgcaggtcatcacctccaagcagcgcccacgcaaactcacc
atcatgggtagtaatggccacgagttcatgttcctgttgaagggccatgaggacttgagg
caggatgagagagtcatgcagctgttcggtctggttaacacgcttctggcaaacgaccct
gcgtccttgcgcaagaacctcagcattcagcgctacgcagtgatccccctgtccaccaac
tcgggcctgattggctgggtgccccactgtgacaccctgcatgccctcatcagagactac
agagagaagaaaaagattttgctcaacattgaacatcgcatcatgctcaggatggctcca
gactacgaccacctgacgctgatggagaaggtggaggtgtttgaacatgctgtcaataac
acagccggagacgacctggccaagctcttgtggctcaagagccccagctctgaggtgtgg
ttcgacaggaggacgaactacactcgatccctggctgtgatgtccatggtgggctacatc
ctcggactgggtgacaggcatccatccaatttgatgttagaccggttaagcggcaagatc
ctacacatcgactttggagactgttttgaggtggccatgaccagagaaaagttccctgaa
aagattcccttccgactgactaggatgctaaccaatgctatggaggtgacgggcttggat
ggtaactacaggatcacgtgccacacagtgatggaggtgctgagggagcaccgggacagc
gtcatggctgtgctggaggccttcgtctacgacccgctgctcaactggaggcttatggac
acaaacacaaaaggaaccaaacgctcccgcaccaggaccgactcgtacaccgccgggcag
tcagttgaggctcttgagggaattgaccttggagagaccacgcacaagaaagcagggacc
actgtgcccgagtcgattcactccttcattggagatggcttggtacaacctgaggcactc
aacaagaaggctattcagattattaacagagtgcgagacaaacttacgggtcgtgacttc
tctaacgaagagacgctggatgtgccgacacaagtagagctcctcatcaaacaagccacc
tcacatgaaaatctgtgccagtgctacatcggatggtgtcccttttggtga

DBGET integrated database retrieval system