KEGG   Maylandia zebra (zebra mbuna): 101471693
Entry
101471693         CDS       T02814                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04020  Calcium signaling pathway
mze04144  Endocytosis
mze04510  Focal adhesion
mze04540  Gap junction
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101471693 (pdgfra)
   04020 Calcium signaling pathway
    101471693 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101471693 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101471693 (pdgfra)
   04540 Gap junction
    101471693 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101471693 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101471693 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mze04090]
    101471693 (pdgfra)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101471693 (pdgfra)
Protein kinases [BR:mze01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101471693 (pdgfra)
CD molecules [BR:mze04090]
 Proteins
  101471693 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_5 Herpes_gE Receptor_2B4
Other DBs
NCBI-GeneID: 101471693
NCBI-ProteinID: XP_004557196
UniProt: A0A3P9CYE3
LinkDB
Position
LG23
AA seq 1460 aa
MDWLKTFVLFGGSLVVLVTVTSGLPPPTILSDQEEFVLQRNSIFNISCTGKRNVVWEEPL
PKNALVYPGYYTSTLFIDNATVENTGYYTCKYEDPDEELEDAEAEIYVFVPDPHVPFVPE
LPRDLVVSMDNMDNYGFNIPCRVSHWDSYVILRKVPSGEAMHALYNNKEGFFSNNLSPGQ
YQCETNVNDQIFRSSIYTVISNDPMEIIASEETLRAGQPFNITCIVPSGLDFQQQWLHPK
KQAKDAVLMKETFPERVVYILSIPRAASEDSGTYECSVTDKRGEVRVKKVAVTVFEENSF
VAMDHSGILSTEFVHSFEETEFTIIIDAYPAPKVIWMKDDKDLQVNYYLFTTTSHQGGNR
YLSILKFRHPLEKDNGNYTIIAQSGSHTAQFSFNLHVKALTAGMIPSSSVPVLLPELDEM
VVTLHTPFTLTCHGQEKLGWETPISLSEQTQEDSNGLFFSTITVDSATASHTGYYTCFYS
RTITEDTAEFSRIYIYVPDPDVPFLESLIPFGNHVLSGYDEMEIQCRVSDPNANVTLINS
DTQQPVPSIYDSKRGALGIFIAGTYVCKAVINGHEFYSEEYIVHGWTDELDVELTAKKTA
LLVGDTITVTCLARGSEILEDHWKYPGKLANRGTKTVRENKRTQEIFYTLTIPQASTKDS
GIYSCSITDILSNRGQTKQLAIQVYASDILSIKPEFREYESAALDKVCEFRAVVNSFPSV
HVSWFKDGYPLSYVTAEISTSLRQINETSYRSVLTLIRAKEEDSGNYTMRVGNGNQSRDI
SLILEIKVPAVIVDLMDVHHGSPQGQSVVCITRGQPTPTVEWFVCKNIKHCANDSSSWVP
IPANSTEITLDSHIDEDNNLESQVMFGHLESTMAVRCLARNEMAVVSREVKLVSNGPHPE
LTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDS
RWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSE
LKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRENFLSLNPEKNKKE
LDIFGINPADESSRSYVILSFESKGDYMDMKQADSTQYVPMLEMSNASKYSDIQRSNYDH
PPSQKDSSEGEMEIMLSDDVNEGLTTTDLLSFTYQVAKGMEFLASKNCVHRDLAARNVLL
SQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLW
EIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCWNSEPEKRPSFLGL
SETVASLLPSSYKRQYERVNHEFLKSDHPAVTRVCMENEDYIGIAYKNQGKLKDRESGFD
EQRLSSDSGYIIPLPDLDPISDEEYGKRNRHSSQTSEESAIETGSSSSTFAKREGETLED
ITLLDEMCLDCSDLVEDSFL
NT seq 4383 nt   +upstreamnt  +downstreamnt
atggattggctgaagacgtttgtcctctttgggggcagtttggtggttttggttacagtt
acctctggactgcctccaccaaccatcttgtctgaccaggaggagtttgtcctacagcgc
aattccatcttcaatataagctgcaccggtaaaagaaacgtggtttgggaggaaccgctg
ccgaaaaatgccctggtttatccggggtattacacttcaacactcttcatagacaacgca
actgtagaaaacacaggttattacacgtgcaaatatgaagacccggatgaagaactggaa
gatgctgaagcagaaatttatgtttttgtcccagatccacacgttccatttgtccccgag
ttacccagagacctggttgtctccatggacaatatggacaattatggattcaacatccca
tgtcgtgtgtctcactgggactcctatgtcatcctgagaaaagtccccagtggagaggct
atgcatgccttatacaacaacaaagaaggcttcttctcaaacaacctatctcctgggcag
taccagtgtgaaaccaatgtgaatgaccagatattccgaagttctatttacactgtaata
tctaatgaccctatggagataatagccagtgaagagacgttgcgagcagggcagcctttt
aacatcacatgcatcgttccttctggcctggactttcaacagcagtggctccatcctaaa
aaacaggctaaggatgcagttttgatgaaggaaacttttcctgagcgggtcgtctacatc
ctcagtatcccacgagccgcctcagaggacagtggcacctatgagtgctctgttacagac
aaacgcggtgaggtcagagtcaaaaaggtggctgtgacggtctttgaggagaattctttt
gtggccatggaccacagtgggattttatccacagaatttgtccacagttttgaggagaca
gagtttactatcattattgacgcatacccagcccccaaagtgatatggatgaaagatgac
aaagacttacaagtgaactactacctctttactacgactagccaccagggaggaaatcgg
tatctgagcattttgaaattcagacatcctctggaaaaagacaatggaaattataccata
attgctcaaagtggctctcacactgctcagttctcctttaacctgcacgtgaaagctctc
actgcaggaatgatcccatcatcttcagtccctgtgctgctgccagagctggacgagatg
gtagttactctccacacccctttcaccttgacctgtcatggacaggaaaaactgggctgg
gagacgccaatcagtttatcggagcaaacgcaggaggactccaacggcttgtttttcagc
accatcacagtggatagtgccaccgcaagccacactggctactacacgtgcttttatagt
agaactatcactgaggatacagcagaatttagcagaatctacatttatgttccagacccc
gatgtcccctttctggaatcactgataccttttggcaaccacgtcctgtctggatacgat
gagatggagatccagtgtcgagtgtctgatccaaatgctaacgtgactctgattaacagt
gacacccagcagcctgtgcctagtatttatgacagcaagaggggcgctttggggatattc
attgctggaacctatgtctgcaaggccgtcataaatggacacgaattctacagcgaggaa
tatattgtccatggttggacagatgagctggatgttgagttgacagcaaaaaagactgct
ctgctggtgggcgacacaataactgtcacctgtctggctcggggatctgagattctggaa
gatcactggaagtatcccggcaaactggcaaatcgtggtacaaaaacagtgcgagaaaat
aagagaactcaggagatcttttataccctgaccatcccacaagcttcaaccaaagacagc
ggcatctactcttgctccatcactgacatactgagtaacaggggccagacgaaacaacta
gctattcaagtttatgcaagtgatatcttgtccatcaagccggagttcagagaatacgaa
tctgcagcgctggataaagtctgtgagttcagggctgttgtcaactccttcccaagtgtt
catgtcagctggtttaaagatggctacccactcagctatgtgactgcagagatctccacc
agccttcggcagatcaatgaaaccagctacaggagtgttctcaccctgatccgagccaag
gaggaggacagcgggaactacaccatgcgggtggggaacggaaaccaaagtcgtgatatc
agtttaatccttgaaatcaaagtgcctgcagtcattgttgatctgatggacgttcaccat
ggctcacctcaaggccagtctgtggtttgcattaccagagggcagccgacacccacggtg
gagtggtttgtctgcaagaatatcaaacattgcgctaatgattcgtcttcgtgggtgccc
atccctgccaactccactgagatcacattggactcacacattgatgaagacaataacctg
gagagccaggtcatgtttggtcatctggaaagcacaatggcagtgcgctgcctggccagg
aacgaaatggctgttgtcagcagggaggtcaaactggtgtccaatggccctcaccctgag
ctgactgtagctgctgctgtgctggtgctcctggtcattgtcatcatctcactcattgtc
ttggttgttatctggaaacagaaaccacgatatgaaatccgctggagggtcatagaatct
gtgagcccagacggtcatgagtacatctatgtggatcccatgcagcttccctatgactcc
agatgggagtttccccgtgacagacttgtgcttggtcgtatcttgggctctggagccttt
gggaaggtggtagagggcaccgcctatgggctcagccgctcccaacctgtcatgaaggtg
gcagtgaaaatgctgaaacccacagcacgctccagtgagaaacaggccctgatgtctgaa
ctcaagatcatgactcatcttggaccccatctcaacattgttaacctcctgggagcatgc
accaagtcaggccctatctacattatcactgagtactgcttctatggggacctggttaac
tatctgcacaagaacagggagaacttcctcagtctgaaccccgagaagaacaagaaggag
ctggatatctttggaatcaaccctgcagatgaaagcagcaggagttatgtgatcctgtca
tttgaaagcaaaggggactacatggatatgaagcaggctgacagcactcagtatgtgccc
atgttggagatgagcaatgcctccaagtactcagacatccagcggtctaactatgaccat
ccaccctcgcagaaagactcgagtgaaggtgaaatggaaatcatgctgtcagatgacgta
aatgaaggcctcaccaccactgacctgctcagctttacctaccaggtggccaaaggcatg
gagtttcttgcctccaaaaattgtgtacatcgagaccttgcagccaggaatgtccttctc
tctcagggcaagatagtgaagatctgtgactttggactggctagagatatcatgcatgac
aacaactatgtatccaaagggagcacttttctcccggtgaagtggatggcaccagagagt
atttttgataacttgtacaccactctgagcgacgtgtggtcttacggcatcctcctctgg
gagatattctccctaggtggcaccccgtacccagggatggtggtggactcgagtttctac
aacaagatcaagagtggatacaggatgtcaaaaccagagcatgcacctcatgatgtgtat
gagatgatgatgaagtgctggaacagtgagccagagaagaggccatctttcctgggtctg
agtgaaacagtagcttcgttgttaccctccagctacaagaggcaatacgaaagagtaaac
cacgagttcctgaagagcgaccaccctgcggttactcgggtatgcatggaaaatgaggac
tacattgggattgcctacaaaaaccaggggaagctgaaggacagagaaagtggctttgat
gaacagcggttgagctctgacagtggctacatcattccccttcctgacctggaccctata
tctgatgaagaatatggaaagaggaacagacacagctctcaaacatctgaagagagcgcc
attgagacaggctccagcagttccacctttgctaagcgtgagggtgagactctggaggac
atcacgctgctggatgagatgtgtctagactgtagtgacctggtggaagacagctttctg
tga

DBGET integrated database retrieval system