KEGG   Maylandia zebra (zebra mbuna): 101471751
Entry
101471751         CDS       T02814                                 

Gene name
gab1
Definition
(RefSeq) GRB2-associated-binding protein 1 isoform X1
  KO
K09593  GRB2-associated-binding protein 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101471751 (gab1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101471751 (gab1)
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   101471751 (gab1)
SSDB
Motif
Pfam: PH PH_11 PH_13 PH_9 zf-piccolo
Other DBs
NCBI-GeneID: 101471751
NCBI-ProteinID: XP_004549397
LinkDB
Position
LG6
AA seq 747 aa
MSGGEVVCSGWLRKSPPEKKLRRYAWKKRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRVI
DLNLCEQVDAGLTFSKKDLENSYIFDIKTFDRIFYLVADTEDEMNKWVRHICDICGFNPT
DDDAAKAAHQSAMGLVVENAPHPGPGVFTNVPAPYQPVSVRHLDSQSSSEEPQDYLWLAN
CESKKPEPSRAHAECSKSTSSETDLNDNLPSHRTPTSSTSSAKHTSHNGFFPPHQTPVSA
PSIYDSPPSRGASLSTDSGFYHLPRSYSQDTVLLPKSASSPPAHPDGADASDLYVFNTPT
RKPSVETQMRNISISYDIPPTPGANSTYQVPRTVSNTGVGGSESGGDVVPPPRPPKPSLS
SSSGLPPPPAERSPTDTYSVPRSASETDGNYCVPTSAGSKALRSNTIGTVDCSRLRKDFG
SQDCYDIPRSFPSDKSCSFDFNESFNTYFKSKGMMPVGSHSTEEVDQNYVPMSANSPSHH
HSGSLPEPMHETNYVPMTPGTMEFSSLGKQVPPPAHMGFRSSPKTPPRRPLLSECQPPPV
DRNLKPDRKGHSPKIIRAGLERTDSQTVGEFPSRRRKVKPAPLEIKPVPEWDEPSTPVRS
PVTRSFARDPSRFPMPTRPPSVHSTASSTDSEDSTEPNYVAMNPNMSTDEAQITKLAPPM
NADGGSSPVVKPKGDKQVEYLDLDLDSGKSTPPRKMKSNGTGITASDERVDYVVVDQQRT
QALKSTREAWSDGRQLTETDTPSKGPK
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgagcgggggagaggtggtgtgctcggggtggctgagaaagtctcctcctgaaaaaaag
ttgagacgttacgcatggaagaagcggtggtttgttcttcgcagcggccgtctgacaggc
gacccagacgtgttggagtactacaagaatgaccatgccaagaagcccattcgtgtgatt
gacctcaacttatgtgaacaggtggacgccggtctgaccttcagcaagaaagatttggag
aacagctacatattcgacatcaaaacctttgaccgcatcttttatctggtggctgacacc
gaagacgagatgaataagtgggtccgccacatctgcgacatttgtggttttaaccccacc
gatgacgatgcagcaaaagctgctcaccagtccgccatgggactggtggtggaaaacgct
ccacacccaggtccaggagtgtttaccaatgtgccggccccttaccagccagtcagtgtg
cgacacctggactcacagtccagttcagaggagccccaggattacctgtggcttgctaac
tgtgagagcaaaaagcctgaacccagcagagctcatgctgagtgctccaagtctacctct
tcagagacagacctgaatgacaaccttccatctcaccgcacgcctacatcctccacttcc
tcggctaaacacacctcacacaatggcttcttcccaccgcaccagactcctgtgtccgcc
ccttccatctatgactcgcctccatcacgcggtgcctccctctcaactgacagtggcttt
tatcatcttcctcgcagctactcccaggacactgtgctgctccccaagtcagcctcctcc
cctccggctcatccagacggcgcggatgcctctgacctttatgtcttcaacacgccgaca
cggaagccctcagtagagacacagatgcgcaacatttctatcagttacgacatcccgccc
acacccggtgcaaacagcacctaccaagtgccccgcacagtatcgaacacaggggtagga
ggctcagaaagcgggggagatgtagtgccccctcccagaccacccaagccttccctcagt
tccagctcaggactcccgccgcctcctgctgagcgctcacctacagacacctatagtgtg
cctcgatcagcctcagagacagatggaaactactgtgtgcccacaagcgctgggagtaag
gctttacgcagcaacactattggcactgtggactgttcacgcctccgcaaagactttgga
tcccaggactgctatgacattcctagatcattcccttctgacaaaagctgctcgtttgac
ttcaatgaaagcttcaacacctattttaaaagcaaaggaatgatgccagtgggtagccat
tctacagaagaggtcgaccaaaactacgtgcctatgagtgccaactcaccgtcacatcat
cactcgggcagtttgccagagccaatgcacgaaaccaactacgtccccatgaccccaggt
actatggagttctcatccctgggaaaacaggttcctccacctgcccacatgggatttcgc
tcaagcccgaagacccctccccgcaggccgttgcttagtgagtgccagcccccacctgtg
gaccgaaatctcaaacccgatcgcaaaggtcacagtcctaaaataataagagcgggttta
gagcgaactgactctcaaaccgtaggtgaattcccaagtcgacgacgcaaggtaaaacct
gctccactagagatcaaaccagtgccagaatgggatgagccaagcacacctgtacgctca
ccagtgacacggtcgttcgctcgagatccttctaggtttccaatgccaacgagacccccg
tcagtgcatagcacggcctccagcactgactccgaggactctactgaaccgaattacgta
gccatgaaccctaatatgtccacagatgaagcacagatcacgaagctcgctccgcccatg
aatgctgacggtgggagtagccctgtggtaaaaccaaagggagacaagcaggtagaatac
ctggacttggatctcgattccggcaagtctaccccacctaggaagatgaaaagcaacgga
actggcatcacagcatcagacgagcgtgtcgactatgtagttgtggaccagcaacgaaca
caggcccttaagagcacccgggaggcctggagcgatggccgccaattgacagagacagac
accccttccaaaggacccaagtga

KEGG   Maylandia zebra (zebra mbuna): 101473094
Entry
101473094         CDS       T02814                                 

Definition
(RefSeq) GRB2-associated-binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101473094
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101473094
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   101473094
SSDB
Motif
Pfam: PH PH_11 PH_8 PH_2 PH_9 zf-piccolo
Other DBs
NCBI-GeneID: 101473094
NCBI-ProteinID: XP_004570166
LinkDB
Position
LG3
AA seq 781 aa
MSGAGDVVCEGWLRKSPPEKKLRRYAWKRRWFVLRSGRLSGEPDVLQYYKNPHSRRPIRN
INLNLCEQVDAGLSFTKKELESSFVFDLRTEERIWYLVAESEEDMNRWVTSICLLCGFNP
TDDVPERPLVSSSTSATSMTPVSHTTTISTMTGLVPPPYDPVSVRHMEPDRNSEEDYLWL
SQCQSHIRAPLGSSTSLETDYNDNLYPPPSATSSSSSSSSSPSLLPSSLPNPSYSSSSSS
SGFRVVPWTVTAMSSPLSQSLDASTTPDSQNRAGRPRCHPSPHPRKHSLDFHLRPVAIPL
SDNVHSNVHPSTHSSTTSGYQIPRPVCTSQPPPPRRPSSTPSVDSLTQAELHASTPTPPP
RPPKPPGIAAQGESSKLATLPRTASEPERRDESVDGGGHLPRSNTVTTPGCMHTSSDSFY
IPRSLSDRASMFDFSESFNSYFFNKGMVPLGSVCSEDDDVDENYVPMSAATSEPPVAPRV
PPPSDPSAQLQEGNYVPMTPLTSSFPTHPTTVMTDMASLGRQVPPPAHMGFRNSALTPLA
PLTPPLRRNTMNTSAGGEQEAVPPPIHRNLKPQRRGVCANQPVDRNESQTPEELTNKTRV
KPAPLDISSVQQDWQEVPPPVRSPVTRTFTRGPSNRRTVTPSSAHSSSPSSDSDDPDDNY
VAMMTSSLSFSAGEQSLRLMMHRASEGGVNSPVLRRARDDKQVEYLDLDLHTGQSTPSRQ
KRCTGEGLTGGSEHAGDGEDQARGQRTRVDYAVVDPKRTKALRSTREARHAGRMSTEKNK
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atgagcggagcaggggacgtggtgtgtgaagggtggctgagaaagtcacccccagagaaa
aaactgaggcgctatgcctggaagaggcgctggtttgtgctgcgaagcggtcgactgagc
ggagagccggacgttctgcaatactacaagaacccgcattcccgtcggccaatcaggaac
atcaatctgaatctgtgcgaacaggtggatgctggcctttctttcacaaaaaaggagcta
gagagcagctttgtttttgacctcaggacagaagagaggatctggtacttggtggctgag
tctgaagaggacatgaaccgctgggtgacatccatctgcctgctctgtggcttcaaccct
actgatgatgttccagaaagacctcttgtctcctcctccacctctgcaacatctatgacc
ccagtcagtcacaccaccaccatctctacgatgacagggttagtcccaccaccatatgac
ccggtgagtgtgcggcacatggagcctgaccggaattcagaggaggattacctgtggtta
tcacaatgccagagtcacatcagggctcctttagggtcatccacatctcttgaaactgac
tacaatgacaacctttacccgcctccctctgcaacctcctcctcttcttcttcttcttcc
tctccttccctcctccccagcagccttccaaatccatcctactcctcttcctcctcttct
tctggctttagagtggtcccttggacagtcactgcaatgtcgagccctctcagccagtct
ttagatgccagcacaacccctgactcccagaatcgagctggcagaccccgctgtcacccc
tctccgcatcccagaaagcactccctggattttcaccttcgtccagtagcaatacctctc
agtgataatgtgcactccaatgtgcatccaagcacacactcatccaccactagtggttac
cagatcccacgtccagtatgcacttcacaaccgccgccccctcgccgcccatcttctacc
cctagtgtggactccctaacccaagcagagcttcatgcctccacccctactcctcctccg
cgcccaccaaaacctcctggcattgcagcccaaggagaaagctcaaagcttgccacactc
ccccgaactgcctcagagccagagaggagggatgagagtgtggatggaggaggacatctg
ccaaggagcaacaccgtcactacaccaggatgcatgcatacaagtagcgactctttttac
atccctcggtctttgtctgacagagcaagcatgtttgatttcagtgagagctttaacagc
tatttttttaacaaaggcatggtccctctgggtagtgtctgttctgaagatgatgatgtg
gatgaaaattatgttcccatgagcgctgccacctctgagccaccggttgcacccagagtg
cctccaccctcagacccctctgcccagctccaagaaggcaactacgtccctatgacccct
ctgacatcttcatttcctacacaccccaccactgtcatgactgacatggcatctctcggg
aggcaggtgcctccccctgcgcacatgggtttccgtaactccgccctgactccccttgct
cctctcactccgccgctcaggagaaataccatgaacacttctgctggaggcgaacaagaa
gccgtgccccctccgatccaccgcaacctgaaaccacaacggagaggggtttgtgccaat
cagccggttgacagaaatgagagccaaactcctgaggagctgacaaataaaacaagagta
aaaccagctcctctggacatctcttcagtgcagcaggactggcaggaagtcccccctcca
gtgcgctcgcctgtaacacggaccttcacccgtggaccctccaatcgtcggacggtcacg
ccgagctctgctcacagctcttcaccgtcctctgattccgatgacccagatgacaactat
gttgcaatgatgacctctagcctcagtttcagtgccggcgagcagtctctgagacttatg
atgcaccgagcttcagagggcggagtcaacagccctgtgttacgacgagccagagatgac
aagcaggtggagtacctggaccttgacctccacactggacaatcaacaccaagcagacag
aaacgctgcactggagaaggtttaaccgggggcagtgagcacgctggagacggcgaggat
caagcacgaggccagcgtacacgtgtggactatgcagtggtggaccccaaaaggaccaag
gccctgaggagcacgcgagaagcacggcatgccgggaggatgtctacggagaagaataaa
ttatga

DBGET integrated database retrieval system