KEGG   Maylandia zebra (zebra mbuna): 101471827Help
Entry
101471827         CDS       T02814                                 

Gene name
kmt5b
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101471827 (kmt5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101471827 (kmt5b)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101471827 (kmt5b)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101471827 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 101471827
NCBI-ProteinID: XP_004568729
LinkDB All DBs
Position
LG1
AA seq 900 aa AA seqDB search
MDSGFKVLSPVFPTQECCFISETKCNWTRGLVGMKWLGESKNMVLNGRRHGNKLTGEQTV
SPSQTRSQHPQRASLRHSKSHTRNRRCSRRFNAASLEAERRYVPSSGMTAKELCENDDLT
TSLILDPYLGFQTHKMNTRFRPIKGRQEELKEIIERFKKHDNLEKAFKALTSGDWARNIF
LHKTKAQEKLFKQHVFVYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIEYL
VGCIAELSESEENLLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRD
TACVKVLRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKSKAGLPVEVPVINS
KYGLRETDKRLNRLKKLGEGNRTSDSHSVGSHTDVDSQEMPKTHQSARKRTSSSSSSSGL
KYKNRTQTRQTLSRALTTSCSKQGRANNNRVPKRLRSQSKPSLSKVQLRSRKRGAEPKAL
AKQETCQLGLTDSKMSLCKGVTVKKEKDGQELVQQTLGQQGYLTRHTAKENGHLPAVQSS
EGSQCSMYRTRRSTRTLVKARETASGVKLEPSAMDGLSPVPGGVVIKTEPADMEEYLHHG
VELEHPSLDAGYARRRSSTRQKRPARIRAERTIKCEDTYGESFMQVVGSHAAEFSDCGNM
LLSFADQHRDYNCVTHGSKSFHRDKGKGSCRSQDKGKKKRRITRYDAQLILENNTGIPKL
TLRRRRDSSSSKTTDPNDPVGSSHLSASTVNSPSSSKISIKFSKDHDKDKGSSYIAKLNN
GFAPVVHSNSTKLNIQLKREDDARRLSQTKVDQISFNGDMSQGLETRNGGHLTQKVLADP
SSDDEDKEVEDDDDYFDNEFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggattcaggtttcaaagtcttgtccccagtcttccccactcaagagtgttgcttcatc
tcagagactaaatgcaactggaccaggggtcttgtgggcatgaagtggctgggcgaatcc
aagaacatggtattaaatggcagacgacatggaaacaagttgactggcgagcagactgtg
agcccgagccagactcgctctcagcatccacaacgtgcatctctgcgccacagcaagagc
cacaccagaaaccgaagatgtagccgcagatttaatgcagccagtctggaggcagaaagg
cgctatgtaccctcctctggaatgactgccaaggagttgtgtgagaatgacgatctaacc
acgagcctcatactggatccatatctgggctttcagacacacaaaatgaacaccagattt
cgacctattaagggaaggcaagaagagctgaaagagataattgagcgcttcaagaaacac
gacaacttggaaaaagctttcaaagctttgacatcaggagactgggctcgaaatatattt
ctccacaagacgaaggctcaagaaaagctcttcaagcagcatgtgtttgtttatctgcgc
atgtttgctacagacagtgggtttgagattctcccttgtaaccgttactcatctgagcaa
aatggagctaaaattgtggcaacaaaggaatggaaaagaaacgataagattgagtacttg
gttgggtgcattgctgagctctcagagagcgaggagaacttactgctgcggcatggagag
aatgacttcagtgtcatgtattcgacccgcaagaactgtgcgcagctgtggcttggacca
gctgcattcatcaatcatgattgtcggccaaactgcaagtttgtgtcaacaggtcgggac
acagcttgtgtgaaagttttaagggacattgagccaggagaagaaatctcgtgctactat
ggagatggtttttttggggaaaacaatgaattttgtgaatgctatacgtgtgaaagacga
ggtactggtgctttcaaatccaaagctggactgccagtggaagtaccggtgatcaacagc
aagtatggattgcgtgagacagacaagcgcctcaacaggctgaagaagctaggggaggga
aataggacctcagacagtcactctgtaggctcgcacaccgatgtagactctcaggaaatg
ccaaaaacacatcaatctgccagaaaaagaacatcatcatcgtcatcatcatctggcctg
aagtataaaaacaggactcaaaccagacagactttgtcaagagcccttactacctcatgt
tcaaaacaaggtcgcgcaaacaataacagggtaccaaagagactaagatcccaatctaag
ccttcgctaagtaaagtccagttgcgaagtcggaaaaggggtgcagagcccaaggcactg
gccaaacaagagacctgccagttgggtctcacggactcaaagatgtcgctgtgtaaaggc
gtcactgtaaagaaggagaaggatgggcaggagctagtgcagcagacactgggccagcaa
ggctatctgacacgtcatactgccaaggaaaatggccacctcccagctgtgcagagcagc
gaaggcagccagtgttcgatgtacagaactcgcaggtccacaaggacccttgtaaaggct
cgggaaacagcatctggtgttaagctagagcccagcgccatggatggtttgagtccagtc
cctggtggggtggtcatcaaaacagagccagctgacatggaggagtacctccaccacgga
gttgagctagaacatccatcattagatgctggctatgccagaagacgctcaagcaccagg
cagaaacggccagcacggatcagggccgagcggacaattaaatgcgaagacacatatggg
gagtccttcatgcaagtggttggcagccatgctgcagagttctcagattgtggaaatatg
cttttgagctttgctgaccaacatagagactacaattgcgtcacccatggcagcaaatct
ttccaccgggacaagggaaagggtagttgccggtctcaggacaaggggaagaagaagcgt
cggatcacaagatacgatgctcagttgatcctagagaataacacaggcatccccaaactg
acgctccgccggcggagggatagcagcagtagcaagaccactgaccccaacgatcctgtt
ggctcctcccatctttcggcatctacggtcaattcaccttcttcgagcaaaattagcata
aagttcagcaaggatcatgacaaggataaaggcagctcctacatcgccaaactgaataac
ggttttgcccctgtggtccacagcaattccaccaagctgaacatccagttgaagcgggag
gatgatgcacgaagactatcacagacaaaggtggaccagatttcctttaatggagacatg
agtcaaggtctagagaccaggaatggtggacatctgacccaaaaggtcctggcagaccct
tcgtctgatgatgaggacaaggaagtggaggatgacgatgactactttgataatgagttt
gaagacgatttcattccacttcctccagcaaagcggctccgactcattgtgggtaaagac
tccatagacattgatatctcctccaggaggagagaggatcagtctctgaggctcaatgca
taa

DBGET integrated database retrieval system