KEGG   Maylandia zebra (zebra mbuna): 101471946
Entry
101471946         CDS       T02814                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04020  Calcium signaling pathway
mze04260  Cardiac muscle contraction
mze04261  Adrenergic signaling in cardiomyocytes
mze04270  Vascular smooth muscle contraction
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101471946 (cacna1c)
   04020 Calcium signaling pathway
    101471946 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101471946 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101471946 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    101471946 (cacna1c)
   04270 Vascular smooth muscle contraction
    101471946 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mze04040]
    101471946 (cacna1c)
Ion channels [BR:mze04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101471946 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 101471946
NCBI-ProteinID: XP_012773814
LinkDB
Position
LG17
AA seq 2291 aa
MLRGLFERKPKHERLQEEPEVRFRGLLVTERDLGYRYIPPGGSDYSPPPPLPRPPPPGLT
NEHSGGTSHGDHGGGGGGVNHGVGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAAS
GGGAGLGSGGRGPISTASSTQRKRQHYTAKPKKQTTTTATRPPRALLCLTLKNPIRRACI
SIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKV
IAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTC
VHNLTGTIAEEKPAPCAPDGAYGRHCKQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGMDDEKPRNRELSMPASENESVNTD
NAPGGDVEGETCCTRLAIRISKSKFSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLN
TLTIASEHHQQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVC
GGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLL
LFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPAFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RLGSPEKRHENEKPPLEEEKKEKIELKSITSDGETNTATKINMDDCCGDESEEKNPYPAN
DYIGDEDDDEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSHTNKFRVLCHKVVNHN
IFTNLILFFILLSSISLAAEDPVKNDSFRNKILGYADHVFTGLFTIEIILKMTAYGAFLH
KGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDNSKQTQAECRGSFITYKDGD
VGKPDKAPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRV
VISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTG
LFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSIVDIAITEVNGLQNSEENARISITFF
RLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALR
DHMQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPKQPCEKGSTNESSSSNEDCGS
QFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAK
GRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTA
LRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR
KFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAISGDLNVEEELDKGVKEPVSA
ASEDDIFRVKRTGGLFGNHVNYYNQSDGRGSFPQSFTTQRPLHISQKGSPCEGESPSHEK
LMDSTTFTPSSYSSSDSNANINNANNTGMAGVATQGISRFPSPSISTVDGHTGQPLTPIL
LPRSAWCFPPKRTCFYDSLMRSDSCDSHLPIIRRGEGSTEETYDESYVEDRVYHEDDHSL
SSDMLVYHDETCKQLTPMEEAEEVDDRRGGGGWQSPRRVFLCPTSLGRRSSFHLECLRRQ
SRPDVSQKTAVPLHLVHHQALAVAGLSPLLRRSHSPTLFSRLCSTPPASPTAQCSDASYQ
RVPSLRLEGSNSHEKLNTSLPSVNCGPWYNDSNGNSPVPSPSPTPSMPASSQRAPRPVSL
TVPSLLGKDSSSLCHGSAGSLVEAVLISEGLGHFAQDPSFIEATKAELADACDMTIEEME
HAANNILNGTSPTNATSSTSSTSQHSPNGNVLPFHTTAAAASTHRDRVVGLSPSEGGGEA
TGSRGSIHGPSSIEERQELLAREREPEEEEEEEEAGGREEGHYRGSLVIGGARQRNSGLL
EDEDMECVTSL
NT seq 6876 nt   +upstreamnt  +downstreamnt
atgctgaggggcctgtttgagaggaaacctaaacatgagaggctgcaggaggaacccgaa
gtcagatttagaggattgctggtgacagagagagacctgggatatcgatacatcccacct
ggaggctccgactactctccccctcctcctcttcctcgacctcctccacctggcctgacc
aatgagcacagtggtggcactagccatggcgaccatggtggaggagggggcggggtcaac
catggagtgggcgtggttggtctggctccagagcacatccccacaccgggggcagccctg
agctggcaggcggcgatcgatgccgcgcggcaggcgaagatgatgggtaatgccgcatcg
ggtggaggggcggggcttgggtccggagggcgagggcccatctccacggccagctccacg
caacggaagagacagcactataccgccaaacccaagaaacaaaccacaacgacagccaca
aggccgccacgagctctactctgcctcacactcaagaatcctatccgcagggcctgcatc
agcatcgtagagtggaaaccatttgagatcatcatcctgatgacaatttttgccaactgt
gtggccttagctgtctacatcccctttcctgaggatgactcgaacgccaccaactccaac
ttggagcgtgtggagtatctgttcctcatcattttcacggtggaggcgttcctgaaggta
atagcctacggcctgctcttccaccccaacgcctacctgaggaatggctggaatctgcta
gacttcatcattgtagttgtagggttattcagtgcaatcttggagcaggccacaaaaggg
gatggggctactcctattggagggaaagcggcgggctttgatgtcaaggctctgagggca
ttcagagtactcagacccctcagactggtctctggagtaccgagtttacaggtagtgttg
aactccataatcaaagccatggttcctctgctccatatcgccctgctggtcctcttcgtc
atcatcatctatgccatcatcggtctggagctcttcatgggcaagatgcacaagacctgc
gttcataacctaacaggcactattgcagaggaaaagccagcaccatgtgcacctgatgga
gcttatggtcgacattgcaagcagaatggaacacagtgcagagttgggtgggagggccca
aacgacggcatcacaaacttcgacaactttgcctttgccatgttaacggtgttccagtgt
ataaccatggaaggctggacggatgtgctgtactggatgcaggatgccatgggctatgag
ctgccatgggtctattttgtctctcttgtcatcttcggctcttttttcgttctcaatctc
gttctgggagtgttgagcggagagttttccaaggagagagagaaggccaaggcgcgcggt
gacttccagaaactcagagaaaaacagcaactggaggaagacctcaagggctatttagac
tggatcactcaagccgaagacattgacccagagaatgaagaggagggtatggacgatgag
aaacccagaaatcgtgagttgagcatgccagccagcgagaatgaatccgtcaacacagac
aacgcccccgggggagacgtagagggtgagacctgctgtacccggctggcaattaggatc
tccaaatccaagttcagccgctactctcggaggtggaacaggctgtgtcgaaggaaatgc
cgggcagcagtcaaatcacaagttttctattggctggtcattttcctggttttcctcaac
actctgaccattgcctctgaacatcaccagcagcctcagtggctaactgatgtacaagac
atagccaataaggttttgctagcactctttactggtgagatgctgttgaagatgtacagt
ctgggcctgcaggcctactttgtttcactcttcaatcggttcgacagcttcgtagtatgt
ggagggatccttgaaaccattctggtggaaacaaaaatcatgtctcctcttggcatctct
gtgttacgttgtgtacgcttactccgaatcttcaaaataaccagatattggaactctttg
tccaacctggtggcatccctgctgaactctgtccgctccatcgcttccctgctgctcctg
ctgttcctcttcatcatcatcttctccctgctgggcatgcagctgtttgggggaaaattc
aactttgacgagaccagacgaagcacgtttgacaacttcccccagtctctgctcactgtg
tttcagatcctgaccggagaggactggaactctgtgatgtatgatggtatcatggcgtac
ggtggtccagcttttcctggcatgctagtttgcatctacttcatcatcctcttcatctgc
ggaaactatatcctgctgaatgtcttcttggccattgctgtagacaatctggcagacgcc
gagagcctgacatcagcccagaaagaggaagaggaggagaaggagaggaaaaaactggcc
aggcttggcagtccagagaagcgtcatgaaaatgagaagccgcctctggaggaagagaag
aaggagaaaatagagctgaagtccattacttctgatggggagaccaacactgctacaaag
attaacatggatgactgctgtggggatgagagcgaagagaagaatccatatcccgccaat
gattatataggagatgaagacgatgatgagccagagatgcctgtgggcccgaggccacgg
cccctctctgacattcagctgaaggagaaggctgtccccatgcctgaggcccgagctttc
tttatcttcagccacaccaacaagttcagggttctctgccataaggtcgtcaaccacaac
atcttcaccaacctcatcctcttcttcatcctgctcagcagcatcagtctagcggcagaa
gaccctgtcaaaaatgactccttcagaaataagatcctgggctatgcagatcatgtgttt
actggactcttcaccatcgagatcattcttaagatgacagcctatggcgccttcctccac
aaaggttctttctgtagaaactattttaacatcctggacttggtggtggtcagcgtgtcc
ctcatctcctctggaatacagtccagcgcaattaatgttgtaaaaatcctgagagttctg
cgcgtgcttagaccactgagggccatcaacagagccaaaggactaaagcatgtagtgcag
tgcgtgtttgtggccatcaggactattggcaacatcgtcatcgtcaccacgttactccag
ttcatgttcgcctgtattggagtgcaactctttaagggcaagttcttctactgtaccgac
aactctaagcagactcaggcagagtgcagaggttctttcatcacatataaagacggggat
gtggggaagcctgacaaagccccaagagtgtgggagaacagtgactttaactttgatgat
gttctacaaggcatgatggcactgtttgccgtgtctaccttcgagggatggccagggtta
ctgtaccgagccattgactctcatgctgaggatgtggggcccatttacaactaccgcgtg
gtcatttccatcttctttatcatctacatcatcatcattgccttcttcatgatgaacatt
ttcgtcggtttcgtcatcgtcacattccaggaacaaggggagcaagaatataagaactgc
gagctggacaaaaaccagcgtcagtgcgtggagtacgctctaaaggctcgtccgctgcgt
cgctacatccccaagaacccttaccagtacaaggtgtggtatgtggtcaactccacctac
tttgagtatttgatgttcacactcatccttctcaacaccatctgtctggccatgcagcat
catggacagaccaaaaatttcaatgatgccatgaacatcctcaacatgctcttcacggga
cttttcactgttgagatgatccttaaactgatcgccttcaaacccaggcattattttgtt
gatgcatggaacacatttgatgccttgatagttgtgggtagcattgttgacatagcgatc
actgaggttaacggactgcagaactctgaagagaacgccaggatctccatcaccttcttc
cggctgttccgcgtgatgaggctggtgaagctgctgtctcgcggggaagggattcggacc
ctgctgtggaccttcatcaaatccttccaagctctgccctacgtagctctgcttatagtg
atgctgttcttcatatacgccgtcattggcatgcagatgtttggtaagatagctctgcgg
gaccacatgcaaatcaacaggaacaacaatttccagacattccctcaggcggtgctgctg
ctcttcagatgtgcaacaggtgaggcgtggcaggagatcatgctggcgtgttcacccaaa
cagccgtgtgagaaaggatcaaccaatgaaagcagctcgtccaacgaggactgtggcagc
cagtttgccatcatttattttgtcagcttctacatgctctgtgccttcctgatcatcaac
ttgtttgtggccgtcatcatggacaactttgactacctgacgcgtgactggtcgatcctg
gggccacatcatcttgacgagttcaagaggatctgggctgaatatgacccagaagctaag
gggagaataaaacatcttgatgtggtgactctgctcagaagaatccagcctcccctcggg
tttggaaagctctgtccacacagggtggcttgcaagcgtctggtgtcgatgaacatgcct
ctgaacagcgacggaacagtgatgttcaacgccacactgtttgccctggtcagaaccgca
ctcaggataaagacagaagggaacttggagcaggccaatgaggaactgagggcaatagtg
aagaagatatggaagagaaccagtatgaagctcttggatcaagtagtgccccctgctggt
gatgacgaggtaacagtcgggaaattctacgccaccttcctcatccaggaatatttccgc
aagtttaagaaaaggaaagaacaagggctggtggccaaggtgccccccaaaaccgcactc
tctctgcaggcgggcctgcggacattgcacgacatcggtccggagattaggagagccatc
tccggagacctaaatgtggaggaggagctggataaaggtgtaaaggagcctgtgtcagcg
gcgtctgaggacgatatcttcagggtaaagcgcacaggagggttgtttggcaaccatgtc
aactactacaaccagagcgatggccgtgggtccttcccgcagtctttcactacccagcgt
cccttgcacatcagccaaaaagggtcaccttgtgaaggcgagagcccgtctcatgagaag
ctcatggattcaactactttcaccccttcctcttactcctcatcagactctaacgccaac
atcaacaatgccaacaacactggcatggccggggtggcaacccagggcatcagtcgattc
ccgagcccatctataagcactgtggatgggcacacggggcagccactcacccccattctg
ctgccaagatctgcatggtgctttcctccaaagaggacgtgtttttatgacagcctcatg
cgctcagactcgtgtgacagtcatctgccaatcatccgaagaggggaggggtcaacagag
gagacatacgacgagagctatgttgaagacagggtgtaccatgaggatgaccactcgctc
tcgtctgacatgctggtgtatcacgatgagacttgtaagcagttgactcccatggaggaa
gcggaggaagtcgacgacagaagaggaggaggagggtggcagtctcccaggagggtcttc
ctctgtcccacttctctggggcggagatcgtccttccatctggagtgtctccggagacag
tcgaggccagacgtctctcagaagacggctgtacctttacatcttgtacatcatcaggct
ctggctgtagcagggttgagtcctctgttaagacggagccactcaccgaccctcttcagt
cggctgtgctccacacctccagcaagtcccacagctcaatgcagtgatgcctcctaccag
cgagttccctctctgaggctagagggctccaactcccatgaaaagctcaataccagcttg
ccctctgtcaattgtggcccatggtacaatgacagtaatgggaatagcccggtgcccagt
cctagccccacccctagcatgccagcgtccagtcaaagggcaccgaggccggtgtcgctc
actgtgccgtcgctgttggggaaagactccagctcgctgtgtcacggcagcgcaggcagt
ctagtggaggcagtcctaatatcagagggcttgggtcattttgctcaggacccctcgttc
attgaggcgaccaaagcggagctggctgatgcctgcgacatgaccatcgaggagatggag
cacgccgccaacaacattctcaacggcacctcgcccacaaacgccacatccagcacctcc
tccacctctcagcacagccctaacggcaacgtcctccccttccacacaacagcagcagca
gcatcaacgcacagggaccgagtggtcggcttgagtcctagtgaaggtgggggagaagct
acaggaagcagaggctccatacacggtccctcctctatagaggagcggcaggagctgcta
gccagagagagagaaccagaagaggaggaggaagaagaggaggcaggagggagggaagag
gggcactatagaggctcgcttgtgatcggaggagcacgacagaggaacagcgggctgttg
gaggacgaggatatggagtgtgtgacaagcttatag

DBGET integrated database retrieval system