KEGG   Maylandia zebra (zebra mbuna): 101471989
Entry
101471989         CDS       T02814                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze03013  RNA transport
mze04012  ErbB signaling pathway
mze04150  mTOR signaling pathway
mze04218  Cellular senescence
mze04910  Insulin signaling pathway
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101471989
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101471989
   04150 mTOR signaling pathway
    101471989
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101471989
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101471989
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101471989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mze03019]
    101471989
Messenger RNA biogenesis [BR:mze03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     101471989
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 101471989
NCBI-ProteinID: XP_004538384
UniProt: A0A3P9CKB5
LinkDB
Position
LG7
AA seq 119 aa
MSAGGQATRNRDIPAVRRVAIHDAAHLPNDYSTTPGGTLFSTTPGGTRIIYDRKFLLQCR
TSPLTRTPPNLPDIPGVTRPLKPDASSDTNQPDQSLSNNTDHSVHAESAGEDAQFEMDI
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtcagcgggaggccaggccaccaggaaccgggatatccccgccgtcaggcgggtcgct
atccacgacgctgcgcatttgccaaacgactactccacgaccccgggaggaactctgttc
agcaccacgcctggaggtaccagaatcatctacgacaggaagttcctcctgcagtgtcgg
acatctcccctgactcgcacgccgcccaacctgcctgacatcccaggcgtcactcggcca
ctcaagcccgatgcctccagcgacacaaaccagcccgatcagtcgctcagcaacaacacg
gaccacagcgtgcatgcagagagcgcaggtgaagatgcccagtttgagatggacatctaa

KEGG   Maylandia zebra (zebra mbuna): 101475717
Entry
101475717         CDS       T02814                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 2
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze03013  RNA transport
mze04012  ErbB signaling pathway
mze04150  mTOR signaling pathway
mze04218  Cellular senescence
mze04910  Insulin signaling pathway
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101475717
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101475717
   04150 mTOR signaling pathway
    101475717
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101475717
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101475717
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101475717
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mze03019]
    101475717
Messenger RNA biogenesis [BR:mze03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     101475717
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 101475717
NCBI-ProteinID: XP_004544680
UniProt: A0A3P9CMT8
LinkDB
Position
LG12
AA seq 118 aa
MSTDCQKTTAKAIPSIRRVTINDAEHMPHDYSTTPGGTLFSTTPGGTRIIYERKFLLDCR
SSPLARTPPANLPVIPGVTSPASKDTSKKTQNGELLNNNTAAPNSSAAGDDAQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccaccgattgccagaagaccaccgctaaggccatcccgtcgatcaggagggtgacg
atcaacgacgcggagcacatgccccacgactactccaccaccccgggagggactctgttc
agcacgacccccggcggtaccaggatcatctacgaacgcaagttcctgctggactgtcgc
agttctccgttggccaggacccctcctgccaacctgccagtcattccaggagtgaccagc
cctgcctccaaggacaccagcaagaagactcaaaatggagaactactgaacaacaacacc
gctgctccgaacagtagcgctgctggtgatgacgcacagtttgaaatggacatctag

DBGET integrated database retrieval system