KEGG   Maylandia zebra (zebra mbuna): 101472402Help
Entry
101472402         CDS       T02814                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00030  Pentose phosphate pathway
mze00051  Fructose and mannose metabolism
mze00052  Galactose metabolism
mze01100  Metabolic pathways
mze01200  Carbon metabolism
mze01230  Biosynthesis of amino acids
mze03018  RNA degradation
Module
mze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101472402
   00030 Pentose phosphate pathway
    101472402
   00051 Fructose and mannose metabolism
    101472402
   00052 Galactose metabolism
    101472402
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101472402
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101472402
Protein phosphatases and associated proteins [BR:mze01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101472402
Messenger RNA biogenesis [BR:mze03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101472402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101472402
NCBI-ProteinID: XP_004568552
LinkDB All DBs
Position
LG9
AA seq 790 aa AA seqDB search
MAQPDSKKIFFENLSGAGKAIAVLTSGGDAQGMNGAVRAVVRMGLYVGAKVYFIHEGYQG
MVDGGDNIKEATWESVSSMLQLGGTVIGSARCKEFRTHEGRLKAAHNLVQHGITNLCVIG
GDGSLTGANLFKEEWSGLLNELVEQGLIEADAVQKYSALHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSGLACGADWVLIPEMPPED
GWEEKMCQKLSATRSRGTRLNIIIVAEGAIDRHGKPITSSFVKDLVVKCLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNTSVRVPLMECVQMTQE
VQKAMDQKRFEEAVKLRGRSFENNLKTYKLLAHRKPESELPTSNFNVAVLNVGAPAAGMN
AAVRSAVRVGISEGHKMFAVSDGFEGFYKGQIKEVKWGDVGGWTGQGGSLLGTKRTLPAK
HVEKIAEQMRKHNINALLIIGGFEAFLSLLELLTARGKYDEFCVPMVMVPATVSNNVPGS
DLSIGADTALNAITTTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLASGADAAYIY
EEPFDIKELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGRGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKISAKAMQWVSKKLVETFRQDEGRVFANTEDSCCLLGMR
RRTLVFQPVVQLKDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVVHNR
PKDSDASVAM
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagccggacagcaagaagatattttttgagaacctgtcgggagcgggcaaagcc
attgcggtgctgacgagcggaggggatgctcaaggaatgaatggtgctgtgcgtgctgtg
gttcgaatggggttgtacgtgggggcaaaggtttatttcattcatgagggatatcagggt
atggtggatggtggggataacataaaggaagccacatgggaaagtgtgtccagcatgctg
cagttgggagggactgttatcggcagcgctcgctgcaaagagtttcgcactcacgagggg
cgcctgaaggctgcccacaacctggtgcagcacggcatcaccaacctgtgtgtgatcggt
ggagacggcagtctgacgggagccaacctcttcaaggaggaatggagcgggctgctgaat
gagttggtggaacaaggtttgattgaggccgatgccgtccagaagtactctgcccttcac
attgtggggatggtcggctctatcgataacgacttctgtggaactgacatgacaattggc
actgactcggctttgcacagaatcatcgaggtggtggacgcaattatgacaactgcacag
agtcaccagaggacatttgttttggaggtcatgggcagacactgtggctacctggccctg
gtgagcggcctggcttgcggggcagactgggtgctgatccctgaaatgcctccagaggat
ggctgggaggagaagatgtgtcagaaactatctgcgacccgttccaggggaacaaggctg
aacataatcatagttgcagagggagccattgacaggcacgggaagcctataacctctagt
tttgtcaaggatctcgtggtcaagtgcttgggtttcgacacacgagtgacaattttggga
cacgtgcagagaggaggaaccccatctgcctttgaccgtatcttggccagccgcatgggt
gtcgaggctgttctcgcgcttctggagaccacggccaacacgccggcctgtgtggtgtct
ctgtgtgggaacacatcggtgcgcgtgcctctgatggagtgtgtgcagatgactcaagag
gtccagaaagctatggaccagaaacgctttgaggaggccgttaagcttcggggcaggagc
tttgaaaacaacctgaagacatacaaactgctggctcatcgtaaaccagaatccgagctg
ccgactagcaacttcaatgtggcagtgctgaatgtcggggcccctgcagcgggcatgaat
gctgctgtccgttcagctgtaagggtgggcatctctgaggggcacaagatgtttgccgtc
agtgatggctttgagggattctacaaaggacagattaaggaggtgaaatggggtgatgtt
ggaggttggacgggacagggtggctccctgttggggacaaaaagaacacttcctgcaaaa
cacgtggagaaaattgctgagcaaatgcgaaagcacaatataaatgctttgctgattatc
ggtggattcgaggccttcctgtcactgctggaattgttaacggctcgtgggaaatatgac
gagttctgtgtgcccatggtcatggtcccagccactgtctccaacaatgtgccgggctct
gacctcagcattggcgctgacacggctctgaacgccatcactactacctgtgaccgcatc
aagcaatcagccagtgggaccaagagacgtgtgttcattattgagactatgggaggctac
tgtggctatctggccacggtggggggcctggcttcaggggccgatgctgcttacatctac
gaggagccgtttgacatcaaagaactgcaggccaatgttgaacatctgacagagaaaatg
aagacgagcattcagagaggtctggtcctcaggaatgagaactgcaatgagaactacaca
acagacttcatctatcagctgtactctgaagaaggcaggggggtgtttgactgcaggaag
aatgtgctgggacacatgcagcagggaggagcgccatctccatttgaccggaactttggg
accaagatctcagccaaggccatgcagtgggtctccaaaaagctggttgagacgttcaga
caagatgaaggccgagtgtttgctaacaccgaggactcctgctgtctgctgggaatgcgc
cgcaggactctggtcttccagcctgtggtccaactcaaggatgagactgactttgttcac
aggatccccaaggagcagtggtggctgaagctgcgtcctttgatgaagatcttggctaag
tacaagacgagctacgacgtctccgactccggacagctcgagcacgtcgtacacaatcga
ccaaaagactcggacgcttcggtggccatgtga

DBGET integrated database retrieval system