KEGG   Maylandia zebra (zebra mbuna): 101472438Help
Entry
101472438         CDS       T02814                                 

Gene name
col4a5
Definition
(RefSeq) collagen alpha-5(IV) chain
  KO
K06237  collagen, type IV, alpha
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04510  Focal adhesion
mze04512  ECM-receptor interaction
mze04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101472438 (col4a5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101472438 (col4a5)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101472438 (col4a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101472438 (col4a5)
   00536 Glycosaminoglycan binding proteins [BR:mze00536]
    101472438 (col4a5)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101472438 (col4a5)
Glycosaminoglycan binding proteins [BR:mze00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   101472438 (col4a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 101472438
NCBI-ProteinID: XP_024656971
LinkDB All DBs
Position
Unknown
AA seq 1657 aa AA seqDB search
ACHGCAGSKCDCSGVKGEKGERGFPGLTGQPGVPGFPGPEGPIGPRGEKGSDGPQGPGGP
KGIRGPPGTPGFPGTPGLPGLPGQDGPPGPRGVPGCNGTKGDRGFPGSPGIPGQPGLQGP
PGLPGQKGDPGDVISANRFGEKGAVGLPGLPGGPGRPGPPGIQGPVGPPGPRGLEGRPGA
PGPPGPKGNMGLNFQGPKGEKGAPGLQGPPGPPGQVGEQTKPAETEIQRGDKGDQGPPGP
KGDPGLPGPPGPYGGQKGEKGEPGELGKRGKPGKDGDPGSPGYPGPPGETGQPGLPGRDG
ETGQKGDRGFPGPPGQVIGGPIGNQVGPKGEPGLPGTPGLKGDRGVQGLTGPPGEPGFTG
TGSGGFPGPQGFPGEQGQKGEIGPPGNFLPGPPGRAGSPGSPGPPGPRGLPGTSSGQDCI
PGLPGVPGAQGGRGFPGEIGQKGEKGDTCVNCIGSVNPIPGPQGPPGPPGFPGPPGAQGF
KGDRGFPGTPGSVGPSGPPGAQGPPGLNGEKGDPGDPIRVNGLSGEKGDTGFPGPPGLPG
LDGAPGRDGAPGPPGPKGAPGSLLVKGERGLPGEPGFPGNPGDRGPPGLPGFGNPGPRGE
RGIQGVSGRPGPVGAPGTKGEPGQTMTEKGAKGERGRDGEPGQPGSPGIPGQPGQPGFPG
LSGAKGEPGIPGIGLPGPPGPKGFPGVGGQPGAPGGPGRPGIDGRPGELGFPGPKGEPGL
GLPGPPGLTGAPGPKGSTGPKGDPGFPGNPGLSGRLGADGAPGFKGEPGTPGTPGSRGPP
GPPSFGGTGPPGLPGPPGPMGPPGLPGSDGPKGDPGPPGLDIPGPPGDPGAPGYQGLPGT
IGTPGPPGGPGRDGLPGLPGQKGDMGPNGPPGPSGGPGAPGGPGAPGFKGEPGFPGRDGA
PGGPGAKGERGDMGLQGPPGPSVPSQLLKGQKGDPGPSGGTGFPGPKGATGLPGDPGFPG
TDGSPGRPGPPGSKGDSGRPGGPGIPGSPGPKGQMGDMGIPGPPGLKGVSGVSGIPGSPG
QPGPPGNQGPKGEPGSAGVGPPGLTGQKGDPGLPGYPGNPGLKGNPGLPGPTGVTGRPGD
KGDPGLPGFQGPPGIPGPKGLDGVPGTPGSSGAPGRPGEPGPQGQSGPPGEKGQAGRDGI
PGPAGVKGEAGIPGYGGPGPAGSPGLPGIKGDTGPPGVPGNPGFPGPKGDPGSPGGPGEQ
GAPGFPGPAGLSLPGPKGATGPPGLPGRAGPAGPPGSPGLQGPRGLPGTGGVKGEKGTLG
MPGIPGIPGQKGDPGFPGNPGIPGPTGPAGIKGDSGQPGVPGFPGLKGDLGYPGPSGPPG
DRGLPGERGTPGDPGEGSPPIVLKGERGPPGLQGLPGSPGPPGLPGQPGGSGIKGDPGGP
GSDGPPGFNGPAGRKGDIGPAGQPGQPGNPGPRGSDGPQGPPGVPGSVSAAHGFLITRHS
QTTDDPECPTGTKFIYNGYSLLYVQGNERAHGQDLGTAGSCLRRFSTMPFMFCNINNVCN
FASRNDYSYWLSTDRPMPENMAPFVGENIRPHVSRCRVCEAPAMVIAIHSQTIQIPSCPE
NWEVLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSSPFIECHGRGTCNFYANSYSFW
LATVETSEMFRKPQSETYKAGSLRTRVSRCAVCMKRT
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
gcttgccatggatgtgcaggatccaaatgtgactgcagtggagtgaaaggagaaaagggt
gaaaggggtttcccaggtttgacaggacagccaggcgtcccaggattccctggaccagaa
ggaccaattgggcccagaggagagaagggaagtgatggacctcaaggaccaggtggtcca
aaaggaattagaggacctccaggaacaccaggatttccaggaacacccggactcccaggt
ctacctgggcaggatggtcctccaggtccaagaggagtgccgggttgcaatgggacaaag
ggtgacaggggtttcccaggaagtccaggaatccctgggcagccaggacttcaaggtcca
cctggtctgccaggacaaaagggagacccaggtgatgttatctccgccaatcgtttcgga
gagaaaggagcagtgggtttacccggtttgccaggaggtcctggccgacctggacctcca
ggtatacaaggtccggtaggtcccccaggacccagaggccttgagggtcgtccaggtgct
cctggtccacccgggcctaaggggaatatgggtttgaatttccaaggacccaaaggagaa
aagggtgccccaggtttgcaaggacctcctggtcctccaggacaggttggggagcagaca
aagccggctgagactgaaattcagagaggagacaagggtgaccaaggacctcctggccct
aaaggtgatccgggtttaccgggacctcctggtccctatggtgggcagaaaggagaaaag
ggagaaccaggagagctgggaaaacgaggaaaaccaggcaaagatggtgatcctggttct
ccaggatacccagggccccctggagagacaggccagcctggtcttccagggagggatggt
gagacaggacaaaaaggtgatcgtggattcccgggtccaccagggcaggtgattggcggg
ccaatagggaatcaggtggggcctaaaggtgaacctggcttacctggaacacctggactc
aaaggagacagaggagtacaaggtttgacaggccctccaggagaaccgggattcacagga
accggtagtgggggttttcctggacctcaaggtttcccaggagagcaaggtcagaaggga
gagattggccctccaggaaactttctgccaggccccccaggtcgtgcagggtctcctgga
tcccctggtccgccagggccccgtggacttccaggcacttcctcaggtcaagactgcata
ccaggacttcctggggttcctggtgcacaaggaggaagaggtttccctggagagatagga
cagaaaggtgagaaaggtgacacctgtgtgaactgcataggaagcgtcaatcccatccct
ggacctcaaggacctccaggacctcctggatttcctggacctcctggcgcccaaggtttc
aagggagacagaggttttccaggaacacctggctctgtcggccccagcggtcctcctggt
gctcaaggtcctcctggcctaaatggagagaagggagatccaggtgatcccatcagagtt
aatggtttgagtggagagaagggtgacactggtttccctggaccacctggtctgccaggt
ctggacggggcgcctggtcgtgacggagcccctgggcctccagggcctaaaggagctcct
ggctcattgttggtgaaaggagaacgaggcctccccggtgagccaggtttccctggtaat
ccaggagacaggggccccccaggtcttcctggctttggaaatccaggacctcgtggagag
agaggtatccagggtgtctcaggaagaccgggacctgttggtgcaccaggaactaagggt
gaacctggtcagacaatgacagagaaaggggccaaaggagaaagaggtcgggatggcgag
cctgggcagcctggttcaccaggtataccaggtcagcctggacagcctggttttcccggt
ttatcgggagcgaagggtgaacccggaatcccaggcattggactgccaggacctccagga
ccaaaaggattcccgggtgttggcgggcaaccaggagcccctggaggaccaggaagacca
gggatagatggacgtcccggtgagctgggatttcctggaccaaagggtgaacctggtctt
ggacttcctggtcctcctggtttaacgggtgcaccgggccctaaaggttccactgggcct
aagggagatcctggtttccctggtaaccccggtttgtcaggacggcttggagctgatgga
gctccaggattcaaaggcgagcctggtacacctggtacacctggatctcgtggcccccct
ggacccccctcttttggtggaacgggcccaccaggtctcccaggacctccgggcccaatg
ggaccaccagggctgccaggatcagatggtccaaaaggagaccctggccctccaggtcta
gacatcccaggcccaccaggagacccaggagctccaggttatcaaggtcttccaggtact
attggaaccccaggaccacctggaggacctggtcgcgatggtttgcctggcttgccaggt
cagaaaggagacatgggtcccaatggacctccaggaccttctggaggaccgggagcccca
ggaggacctggtgctcctggatttaaaggtgaaccaggatttccaggtagagacggtgca
ccaggtggtcctggtgctaaaggagagaggggagacatgggcctccagggaccgccagga
cccagtgttccatcgcagctcttaaagggacaaaaaggagatcctggaccttcaggtgga
acaggttttccgggtccaaaaggtgctactggtctccctggtgaccctgggtttccagga
acagatggcagtcctggccgccctggacctccaggttctaagggagattctggtcgccca
ggaggtccaggtattcctgggtctccaggacctaaaggccaaatgggagacatgggaatc
ccaggaccaccagggctgaaaggtgtttcaggagtgtcgggtataccaggatccccagga
cagccaggaccacctggtaaccaaggacccaaaggtgagccaggttctgctggcgtcgga
ccacctggactaaccggacaaaagggtgatccaggcctgccagggtacccaggaaatcca
ggcctaaaaggaaacccgggattaccaggtcccacaggtgtgacgggaagaccaggcgat
aaaggtgaccccggactcccaggattccaaggtcctcctggtatccccggtcctaagggt
cttgacggtgtgcccggtaccccaggtagctcaggagctccaggtagaccaggagaacct
ggtccacaaggacagtctggtccaccaggagagaaaggtcaggcaggtcgcgatgggatt
ccaggaccagctggagtcaaaggagaagcaggaattccaggttacggtggtccaggtcct
gctggaagtccaggactgccaggtatcaagggagacacaggtcctcctggtgtacccggc
aaccctggttttcccggccctaaaggagacccaggctcacctggtggccctggtgaacaa
ggtgcccctggctttcctgggcctgctgggctgtctctgccaggccctaaaggtgccaca
ggaccccctggattacctggaagagcaggccctgcaggtcctccaggttcacctggccta
caaggtcctcgtggactcccaggaactggtggcgttaagggagaaaagggtactcttggc
atgcctggaattcctggcatccccggacagaagggagatcctggttttccaggaaatccg
ggcatacctggtcctactggccccgctggaataaagggagattcaggacagcctggtgtt
cctggattccctggattgaagggtgatcttggatatcctggccccagtggccctcctgga
gatcgtggattacctggagaacggggcactccgggtgatcccggtgaaggttcgcctccc
attgtgctaaagggagaacggggacccccaggtcttcagggcctacctggttctccagga
ccacctggtttgcctggccaacctggaggctcaggcatcaaaggtgaccctggtggacct
gggagcgatggtcctcctggcttcaacggacctgccggcaggaagggagacattggtccg
gcaggtcagcctggtcagcctggcaaccctggtccccgtggttcagatggcccacaaggt
cctcccggtgtcccaggatcagtttctgctgctcacggtttcctcatcacccgccacagc
cagaccaccgatgacccagagtgccccactggaactaagtttatctataacggatactct
ctgttgtacgtgcagggcaacgagcgggcacacggacaggaccttggcacagccggtagc
tgcctgcgcagatttagcaccatgcccttcatgttctgcaatatcaacaacgtctgcaac
ttcgcatcccgtaacgactactcctactggctgtcaacggacagacccatgcccgaaaac
atggcccccttcgtgggagagaatatcaggcctcatgtcagcagatgtagagtctgtgaa
gctcccgccatggtgattgcaattcacagtcagactatccagattccttcttgccctgaa
aactgggaagtactgtggattggatactcctttatgatgcacaccagtgcgggtgcagag
ggctccggtcaggcgctcgcctcccccggctcctgcctggaggagttccgcagctcccct
ttcatcgagtgccacggcagagggacatgtaacttctatgccaactcctacagcttctgg
ctggccaccgtggaaacttctgagatgttcagaaagccccagtctgagacctacaaggca
ggtagcctacggacacgtgtgagccgctgtgcagtctgcatgaagcgcacgtaa

DBGET integrated database retrieval system