KEGG   Maylandia zebra (zebra mbuna): 101473918Help
Entry
101473918         CDS       T02814                                 

Gene name
dot1l
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101473918 (dot1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101473918 (dot1l)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101473918 (dot1l)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101473918 (dot1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 101473918
NCBI-ProteinID: XP_004552785
LinkDB All DBs
Position
LG23
AA seq 1610 aa AA seqDB search
MGEKLELKLKSPVGAEPAGYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNKRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQIIDEMEMMEEDTFVDLGSGVGQVVLQVAAATNCK
HYYGVEKADIPATYAETMHKEFKKWMKWYGKKHGEYTLERGDFLSEEWKERIANTSIIFV
NNFAFGPEVDHQLKERFANMKEGGKIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLR
GSVSWTGKPVSYYLHTIDRTILENYFASLKNPKLREEQEAARRRQQKDSKSNSTTPTKPK
EPNKQDSCGEEERPSLVTVVKPSAKPRRTRLLAKGRKLNNKKRGRPKKATPAAEKKNKKN
QSALDLLHAKTLSAAPPQDAYRPPQNPFYQLPPKVQHYTPSQLLLSPTPPGLEKLLDNIK
IQYLQFMAYMKTPQYRSNLQQLLDQEKQKHRDLSGQAEQLHLVCQSHKEKIKGLFQTKLD
ELGVKALTVEDLLQAQKEISAHNLQLKEQTKQLERDMALLRDHSLLLLKSRCEELKLDWG
SLCLESLLKEKQALRKQISEKQRHCLELQISIVELEKSQRQQELLQLKSYSPGESSPYRK
NLESRASTDVDSSKLGLSTAPVLNGVSPEFTINGTSSPCFDRVNSKGELLSRYLPISPDH
ELVAATPDARQRQQSFSHALPDYTRFSPAKIALRRHLNQDPTASAHLRGPGLTTHRDLGG
VNSPLGAKQNCPSPNGCDAQNNLKSSERGIKERSPSVQGDNSITSLPISIPLSTVHPSKL
PVSIPLASVVLPSRAERLRSTPSPVSQTGQTNGYSSISSMMNGGLHPEDHNGTSSPPPHS
NTLTMGRGGPTQSPPLSTGGVLQYADGPPRIVPEDGPEGQGGESDAEAQESELRRRIFFS
SSSSSSSSSSSSGSGGSAAGGSRLHHHTGNPAKQGYHSNHGNHHHQSPSTQHVHTPTHTS
SSHSSHSLCSQEGRKRGRRKRGNPGPVMASGSPKRRSFPGLSSSNHSSGSPLNINSMVNN
INQPLEISAISSPEQSSRSPVGPDLDQPPILKRERPLEMNGTGRYSTAPSSDDEDSGYPV
DSSSSRIERKIATISLESRDGSGRLGDGERGRKSGSSSGNSTGSEASSSSSLSSTSKWKS
TFSPISDPKQPNSDLRQGGSPFGIGGSGRGTDSDSDHKQQQVRKGSDGESSYSNPNPFLS
QEASTRGGSSSAGGAQGGSNSDQRQTLQKQKASRDWELKNSGNLASQNLFISAAASSGGG
ILSGKVGGSPVAVSSSTGSSVGQYLGAQFPLGGTSVLQSLFGAQTGGSTVTGTPRLVNGH
SALGSFSSAGLAGGAAGGIFHHVVPSVSSHQFGATLPTSGGLNSLLSLPSSSSSTSSQTQ
QHTTPQPASTRLAPVSSPMPLSLSQAQHSRTQSVLHSPSPPTLSLPPPPPLHSVPSSSTS
THSDSPASSRSDSLHSSRLSLSSLHHQRAQSSLSISSSTSAASVSAAASLSSSSLSASSA
SSSRPFAVHYSPRLPPPPPTSSSGGAGSMWRTQSMHGTYTTSQLPSSRPR
NT seq 4833 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaagctggagctcaagctcaaatcgccggttggagcagaacccgctgggtat
ccatggccgttaccagtatatgataaacaccatgatgctgctcatgaaatcatcgagacc
attcggtgggtgtgtgaggaaatcccagacctcaaactggcaatggaaaattatgtactc
attgactatgacaccaagagctttgagagcatgcagagactttgtgacaagtacaacagg
gccattgacagcattcatcaactgtggaaagggacaacccagcccatgaagctaaacaag
cgtccttccaatgggctgctgagacatatcttacagcaggtgtacaaccactcagtgacc
gacccagagaagctcaacaactatgaacccttctcccccgaggtgtacggagagacctct
ttcgacctggtggcccagattattgatgaaatggaaatgatggaagaagacacctttgtt
gaccttggcagtggagtagggcaggtggtgctgcaggttgcagcagcaaccaactgtaaa
cactactacggtgtagagaaagcagacattccagctacctatgcagagaccatgcataaa
gagtttaaaaaatggatgaaatggtatgggaagaaacacggggagtacacactggaaaga
ggtgattttctgtctgaagagtggaaagaaagaatcgccaacacaagtattatttttgtg
aataactttgcctttggtccagaggtagatcaccagctgaaggagcgctttgctaacatg
aaggaaggagggaaaattgtatcctccaaaccctttgcacctttaaacttcagaatcaac
agtcgaaacttgagtgatattggcacaattatgcgtgtggtggagctttctccactcaga
ggctctgtttcctggactggaaagccagtttcctactacctgcataccatagaccgcacc
atacttgaaaactactttgctagtctcaaaaatcctaaactcagggaggagcaagaggca
gctagaagacgtcagcagaaggacagtaaaagcaatagtaccacgcctacaaaacccaag
gaaccaaacaagcaggactcctgtggtgaagaggagcgtcctagcttggtgactgtggtc
aagccctccgctaaaccgagaagaacgcgactcctggccaaaggtcgcaagctgaacaat
aagaaacgtggtcgacccaagaaagctactccagctgctgagaagaaaaataagaagaat
cagagtgcgttggatttgctgcatgccaagaccctttctgcagcaccccctcaggatgca
taccgaccacctcagaatcccttctaccagctacctcccaaggtccagcactatacccct
agtcaacttctgctgagcccaactccccctggtttggaaaaactgctagacaatatcaaa
attcagtacctccagtttatggcctacatgaagactcctcagtaccgctccaacctgcaa
caacttttagaccaagagaagcaaaaacacagggacctatcagggcaggcggagcagctc
catttggtctgtcagtctcacaaggagaagatcaaaggtctctttcagactaaactggat
gagctgggagtaaaagccctgactgtggaggacctccttcaggcccagaaggagatatca
gcccataaccttcagctgaaggagcaaaccaagcagcttgagagagatatggctttgctg
agagaccacagcttgctgctgctgaagtctcgatgtgaggagttgaagctggactggggc
tctttgtgtctggagagtttgttgaaagagaagcaggccctgcgcaaacagatctccgag
aagcagagacattgcttggagttgcagataagcattgtggagctggagaaaagtcaaagg
cagcaggagctacttcagctgaaatcctacagccctggcgaaagttccccgtatagaaaa
aacctggaatctcgcgcttccacagacgtggactcttctaagctcggcctgtctacagcc
ccagttctcaacggtgttagcccagagtttactatcaacggcaccagctcaccttgtttt
gaccgggttaactccaagggtgagcttctttctcggtacctgcccatatctccggaccat
gaattagtggctgccacccctgatgcccgacagaggcagcaaagcttctctcatgctctt
cctgactacacgcgcttctcccctgccaagattgccttgcgtaggcaccttaaccaggat
cctactgcctctgctcacttaagaggtccagggctgaccacacatagggatctgggtggt
gttaactctccacttggagccaaacagaactgcccctctcccaacggatgtgatgctcag
aataatctcaaaagctcagagaggggcattaaagagaggagtccatctgttcagggagac
aacagcattacaagccttcctattagtatcccactgagcactgttcacccaagtaaatta
ccagttagcatcccactggccagtgtggtgctacccagtcgtgctgagagactgagaagt
actccgagtcctgtgtcacagaccggtcagaccaatggatattcatccatctccagcatg
atgaatggaggtctgcaccccgaggaccataatggcacttcttcaccacctccacacagc
aacactttaacaatgggccgaggcggtccgacccagagcccccctctcagcactgggggg
gtgctccagtatgccgacggacccccgaggattgttccagaagatggaccggagggccaa
ggaggtgaatcggacgcagaagcccaggagagtgaactgcgaaggaggatctttttctcc
tcctcttcttcttcatcctcgtcttcctcttcgtcaggcagcgggggcagcgcagccgga
ggatctcgcctccaccaccacaccggcaacccggccaagcagggataccacagtaaccat
ggaaaccaccaccaccaatcgcccagcacgcagcacgttcacacacccacacatacgtcg
tcatcgcactcctctcacagcctctgctctcaagagggacgcaagcgggggagacggaaa
cgtggcaacccagggcctgttatggccagtggatccccaaagagaagatcattccctggg
ctcagctccagcaaccactcctcaggatcgccactcaatatcaactccatggtgaacaac
atcaaccaacctctggagatctctgccatctcctctccagagcaatcaagccgcagcccc
gttgggcctgacctagaccaacctcccatcttgaagagagagcgccccctggagatgaac
ggcacgggtcgatattccacagcacccagctcagacgatgaggactcgggttatcctgtt
gacagctccagttctcgaattgaaagaaaaatagccactatatcgttggagagcagagat
ggatctggtagactcggagatggtgaacgagggagaaaatcaggaagcagcagtggtaac
agcaccggcagtgaagcctcctcatcgtcatctttgtcctctaccagcaaatggaaatcc
accttttcacccatttctgatcccaaacaacccaactctgacctgagacaggggggctct
ccgtttggcatcgggggttcgggtcggggcacagactcagattctgaccacaaacagcag
caggtgaggaaagggagtgatggagagtccagctacagcaatccaaaccctttcctcagt
caggaggcaagcaccaggggtggaagcagcagtgctggtggtgctcaaggaggaagcaat
tcagaccagcgccagaccctccagaagcagaaggcctcccgtgactgggagctgaagaac
agcggcaatctggccagtcagaacctcttcatttctgctgccgccagcagtggaggaggc
attcttagtgggaaagtgggaggcagtcctgtagctgtttcctcgagcactgggtcgtct
gtggggcagtacctgggggctcagttcccacttggaggaacctcagtcttgcaatctttg
tttggggcccagactggtggatccacggtgactgggacccctcggcttgtcaacggacac
tctgccctaggaagcttctccagtgctgggttggcagggggagcagctggaggtatattt
caccacgtggttccctcagtgtcctcccatcagtttggggcaacgctccccacctcagga
ggcctcaactctctgctcagtctcccctcctcctcttcctctacctcctcccaaacccag
caacacaccactccccagccagcctccacgcgcctggcgcccgtgtcctcgcctatgccc
ctctcgttatcccaggcccagcacagccgcacgcagtcagtcctgcatagcccctctcct
cccacgctctccctgccccctcctccacccctgcatagcgtcccctcctcgtcgacatcc
acgcactctgactccccagcatcttctcgatcagactccctccactcctcgcgtctgtcc
ctctcctctctccaccatcagagagcacaatcatccctctccatctcatcctctacctct
gctgcttctgtctctgctgctgcatccctttcctcttcctctctctcagcctcctctgcc
tcctcctctcgtccatttgcagtgcactactccccccgtctgccccctccgccaccgacc
agcagttctggtggtgctgggagcatgtggaggactcagagcatgcatggtacctacacc
acctcccagctccccagctcccgacctagatag

DBGET integrated database retrieval system