KEGG   Maylandia zebra (zebra mbuna): 101473919Help
Entry
101473919         CDS       T02814                                 

Definition
(RefSeq) fatty acid desaturase 2
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00592  alpha-Linolenic acid metabolism
mze01040  Biosynthesis of unsaturated fatty acids
mze01100  Metabolic pathways
mze01212  Fatty acid metabolism
mze03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    101473919
   01040 Biosynthesis of unsaturated fatty acids
    101473919
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101473919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mze01004]
    101473919
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     101473919
Lipid biosynthesis proteins [BR:mze01004]
 Desaturase
  Front-end
   101473919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 Jiv90
Motif
Other DBs
NCBI-GeneID: 101473919
NCBI-ProteinID: XP_004553068
LinkDB All DBs
Position
LG7
AA seq 445 aa AA seqDB search
MGRGSQQTVPGEPDSGKAKGVYTWEEVQSHNSRNDQWLVIDRKVYNITHWAKRHPGGFRV
IGHYAGEDATEAFTAFHPDSKFVQKFLKPLLLGELAATEPSQDQDKNAAIVQDFKTLRAQ
VEKQGLFQGQPLFFFLHLGHIVLLEALGWMLVSMCGTGWIPTLLCSVILATAQAQAGWLQ
HDFGHLSVFKKSTWNHAVHKFVIGHLKGASANWWNHRHFQHHAKPNIFTKDPDINTLDTF
VLGQTIPVEYGIKKIKHMPYNHQHQYFFLLGPPLLIPVFYNFNIMHTMITRRYWLDLAWA
MTYYLRYFYYYAPLYGVFGSVALFFFVRFLESHWFVWVTQMNHIPMDIDHEKHKDWLTIQ
LQSTCNIEQSFFNDWFSGHLNFQIEHHLFPTMPRHNYHLVAPQVRALCEKHGIPYQEKTL
WRGLADIVTSLKTSGDLWLDAYLHK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtggaagccagcagacggtgccgggagagccggacagtgggaaagctaaaggc
gtttacacctgggaggaagtgcagagccacaacagcaggaatgatcaatggctggtcatc
gatcgaaaggtttacaacatcactcattgggccaaaaggcatccaggagggtttcgagtc
atcggccactatgctggagaggatgccacggaggcattcactgcttttcatcctgattcc
aagttcgtgcaaaagtttctgaagccgctgctgcttggagagttggcagcaacagagcca
agtcaggaccaagacaaaaatgcagccatcgtgcaggatttcaaaaccttgcgagctcag
gtagagaagcagggtctgtttcaaggtcagcctttgtttttcttcctccacctcggtcac
atcgtgctgctagaagccctcggatggatgcttgtttcaatgtgtgggacgggctggata
cccaccttactgtgctcggtgattttagcaaccgctcaggcgcaggctggatggctgcag
catgactttggtcacctgtcggtcttcaaaaagtccacctggaaccacgctgtccacaag
tttgtcattggtcatttaaagggagcttcggccaactggtggaatcacagacatttccag
catcacgctaaacccaacatcttcaccaaggaccccgatatcaacacgctggacaccttt
gtacttggacagactataccagtggagtacgggataaagaagatcaagcacatgccctac
aatcaccaacaccagtacttctttctcttgggacctccgctgctcattccagttttctac
aactttaatataatgcacaccatgataacccggcgatactggctggatttggcttgggcc
atgacatactacctccgctacttctactattatgcacctctatacggcgtgtttggctca
gtggcgctctttttttttgtcaggtttttggagagtcactggtttgtgtgggtgactcag
atgaatcacataccgatggacattgatcatgaaaagcacaaggactggctgactattcag
ttacaatccacctgtaatattgagcagtccttcttcaacgactggttcagtgggcacctc
aactttcaaatcgagcaccacttgttccctaccatgccgcgccacaactaccacctggtg
gcgccacaggtccgcgcactctgtgagaaacatgggattccttaccaggagaaaactttg
tggcgaggccttgctgatattgtcacgtcactgaaaacctcaggagacctctggctcgac
gcttacctccataaataa

DBGET integrated database retrieval system