KEGG   Maylandia zebra (zebra mbuna): 101474059Help
Entry
101474059         CDS       T02814                                 

Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00500  Starch and sucrose metabolism
mze01100  Metabolic pathways
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101474059
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101474059
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mze01003]
    101474059
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101474059
Glycosyltransferases [BR:mze01003]
 Polysaccharide
  Storage polysaccharide
   101474059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glyco_trans_1_4 Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 101474059
NCBI-ProteinID: XP_004564816
LinkDB All DBs
Position
LG15
AA seq 704 aa AA seqDB search
MPLSRSLSMTSLTGVLPAWEEDELPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKITVDEW
GDNYYMMGPYFEHNFKTQVESCEPPNPAIRKAMDALIHNGCQVHFGRWLIEGSPYVILFD
IGSAAWNLDRWKGDLWDTCNIGLPFHDREANDSLILGSLIAWFFKELTDHLGDKPNVISH
FHEWQAGPGLILSRSRKIPMATVFTTHATLLGRYLCAGNTDFYNNLDKFNIDKEAGERQI
YHRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNVKKFSAMHEFQNLHS
TNKAQIQEFIRGHFYGHLDFNLDKTLIFFIAGRYEFSNKGADIFLESLSRLNYLLRVHRN
DVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAHAVKEKFGKKLYDALLKGQIPDLNN
ILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSADPILSNIRRVGLFNSRNDRVKVVFH
PEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFM
EEHVSDPAAYGIYIVDRRFRSAEESCNQLTQFMFSFCQQSRRQRIIQRNRTERLSDLLDW
RYLGRFYIHARHLALSRAFPDKFKMDPMAPLKTEGFRYPRPYSVPPSPSASIHSTPHHSD
VEDDDDEPYDEDEEAERDRMNIKSPFVLNAVPEGKKQQPGESRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtcccgttcgctttccatgacatccctgaccggggtgctgccggcctgggag
gaggacgagctgcctgtggaggacctgctgctcttcgaagtctcctgggaggtcaccaac
aaagttgggggaatctacacagtcatccagaccaaggctaagatcactgtggatgaatgg
ggagacaactactacatgatgggaccatacttcgagcacaacttcaagactcaggtggag
agctgtgagccaccaaatcctgccatcaggaaggccatggatgccctcatccacaacggc
tgccaggttcattttggtcgctggctgattgagggcagcccctacgtaatcctgtttgac
ataggctcagcagcctggaacctggaccgctggaaaggggacctttgggacacctgcaac
attggtctgcccttccatgaccgagaagccaatgactcgctcattttgggctcccttatt
gcatggttcttcaaagagttgacagaccaccttggagacaaacctaatgtcatcagtcac
ttccatgaatggcaggcaggtcctggacttattctctctcgctcacgcaaaattccaatg
gcgacagtattcacaacacatgccaccctgctgggaagatacctttgtgctgggaacact
gacttttacaacaacctggacaagtttaacattgacaaggaggctggtgagaggcagatc
taccaccgatactgcttagagagagcagcagttcactgtgctcacgtcttcacgacagtc
tctcagatcactgctgtggaggccaaccacatgctgcacaggaaaccagatgtggtcacc
ccaaatgggctgaatgtgaagaagttctcagccatgcatgagtttcaaaacctgcactcc
accaacaaggcccaaatccaggagtttatcaggggacacttctatggtcacctggacttc
aacttggataaaaccctcatcttcttcattgctgggcgctatgagttctcaaacaaagga
gcagatattttccttgaatcactgtccagactgaactatctgctgcgggtccaccgaaac
gatgtgacggtcgtagttttcttcatcatgccagcgaaaactaacaacttcaatgtggag
tcactgaaggggcaggcagtacgtaaacagctttgggatacagctcatgctgttaaggag
aaatttggtaaaaagctgtatgatgctctgttaaaagggcagatccctgatctcaacaac
attttggaccgagatgacttcaccattatgaagagagccatctacgccacacagaggcac
agcctccctccagtaaccactcacaacatgctggacgactcagcagatcccatcctgtcc
aacatcagacgtgttggcctcttcaactccaggaacgaccgtgtcaaggttgttttccac
ccggagttcttgtcctcgactagtcctctgctgccaatggactacgaggattttgtccgt
ggttgtaaccttggagtgttcccttcctactatgaaccatggggctacacacctggtgag
tgtactgtaatgggcattcctagtgtgaccaccaatttgtcaggttttggttgcttcatg
gaggagcacgtgtcggaccctgctgcatatggtatctatatagtggaccgacgcttccgt
tctgctgaggagtcctgcaaccagctaactcagttcatgttcagtttctgccagcagtct
cggcggcagcgtatcatccagcgcaaccgaactgagaggctgtctgaccttctggactgg
agatacctgggacggttctacatacatgcacgtcacctggcccttagtagagctttccca
gacaagttcaagatggatcccatggcccctctgaagacggagggtttccggtatccccgg
ccctactcggttccaccctctccttctgcctctatccattccacgccccaccacagtgat
gttgaggatgacgatgatgaaccctatgatgaagatgaggaggccgagagggaccggatg
aatatcaaatctccatttgtgctcaatgctgtgccagaggggaagaagcagcaaccagga
gagtcaagaaactga

DBGET integrated database retrieval system