KEGG   Maylandia zebra (zebra mbuna): 101474234
Entry
101474234         CDS       T02814                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04114  Oocyte meiosis
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04261  Adrenergic signaling in cardiomyocytes
mze04270  Vascular smooth muscle contraction
mze04350  TGF-beta signaling pathway
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04520  Adherens junction
mze04540  Gap junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04916  Melanogenesis
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101474234
   04012 ErbB signaling pathway
    101474234
   04350 TGF-beta signaling pathway
    101474234
   04370 VEGF signaling pathway
    101474234
   04371 Apelin signaling pathway
    101474234
   04068 FoxO signaling pathway
    101474234
   04150 mTOR signaling pathway
    101474234
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101474234
  09143 Cell growth and death
   04114 Oocyte meiosis
    101474234
   04210 Apoptosis
    101474234
   04218 Cellular senescence
    101474234
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101474234
   04520 Adherens junction
    101474234
   04540 Gap junction
    101474234
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101474234
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101474234
   04621 NOD-like receptor signaling pathway
    101474234
   04625 C-type lectin receptor signaling pathway
    101474234
  09152 Endocrine system
   04910 Insulin signaling pathway
    101474234
   04912 GnRH signaling pathway
    101474234
   04914 Progesterone-mediated oocyte maturation
    101474234
   04916 Melanogenesis
    101474234
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101474234
   04270 Vascular smooth muscle contraction
    101474234
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101474234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101474234
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101474234
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101474234
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101474234
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101474234
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101474234
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101474234
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo YukC FTA2
Other DBs
NCBI-GeneID: 101474234
NCBI-ProteinID: XP_004560716
UniProt: A0A3P9BPV8
LinkDB
Position
LG4
AA seq 394 aa
MADTSSTAAVAAEASDSAAVAAAAPVAPDAPPVAPVPRTPAESVKGQIFDVGPRYTNLSY
IGEGAYGMVCSALDNLTNQRVAIKKISPFEHQTYCQRTLREIKILLRFHHENIIGINDII
RAQQLDNMRDVYIVQTLMETDLYKLLKSQRLSNDHVCYFLYQILRGLKYIHSANVLHRDL
KPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSID
IWSVGCILAEMLSNKPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLQSLPEK
PKIPWEKLFYKADPKALDLLGRMLTFNPIKRITVEEALAHPYLEQYYDPSDEPVAEEPFT
FTMELDDLPKERLKELIFEETARFQDNYQPPVRS
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggcggatacaagcagcactgcggcggtcgcggccgaagcctccgacagcgctgctgtc
gctgctgctgcgcctgttgcgcccgatgcaccgcccgtagctccggtgcccaggactcca
gccgagtccgtgaaaggacagatttttgacgtgggcccccgctatacgaacctgtcgtac
atcggggagggtgcttacggaatggtgtgctctgctctggacaacttgacaaaccagcgc
gtagccatcaagaaaatcagcccattcgagcaccagacgtactgccagcgcacgctgagg
gaaatcaagatcctgctgcgtttccaccatgagaacatcatcggcatcaacgacatcatc
agggcacagcagctcgacaacatgagggatgtctacattgtgcagaccctgatggagacc
gacctgtacaagctactgaagagccaaaggctaagcaacgaccacgtctgctacttcctc
taccagatcctgcgaggcctcaagtacattcactccgccaacgtgctgcaccgggatctc
aagccctccaacctgctcatcaacaccacctgcgacctcaagatctgtgactttggcctg
gcgcggatagccgacccagagcacgaccacactggttttttgactgagtatgtggctact
cgttggtacagggctccagaaatcatgctcaactccaagggctactcaaagtccattgac
atctggtcggtgggctgcatcctggctgagatgttgtccaacaaacccatcttccctggg
aaacactacttggaccaactcaaccacatactgggcattcttggctctccatctcaagaa
gatctgaactgcatcattaacttgaaggcgaggaactacttgcagtccctgcctgaaaaa
cccaagatcccgtgggaaaagctgttctacaaggcagaccctaaagctctcgatctgctg
ggccgcatgttgacctttaaccccatcaagcgcatcaccgtcgaggaggccctggctcac
ccttacctggagcagtactacgatccttcagatgagcctgtcgcagaggagcccttcact
ttcaccatggaactggacgaccttcccaaagagaggctgaaggagctgatctttgaggaa
acggcccgtttccaggacaactaccagccgccggttcgctcttga

KEGG   Maylandia zebra (zebra mbuna): 101486997
Entry
101486997         CDS       T02814                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04114  Oocyte meiosis
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04261  Adrenergic signaling in cardiomyocytes
mze04270  Vascular smooth muscle contraction
mze04350  TGF-beta signaling pathway
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04520  Adherens junction
mze04540  Gap junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04916  Melanogenesis
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101486997 (mapk1)
   04012 ErbB signaling pathway
    101486997 (mapk1)
   04350 TGF-beta signaling pathway
    101486997 (mapk1)
   04370 VEGF signaling pathway
    101486997 (mapk1)
   04371 Apelin signaling pathway
    101486997 (mapk1)
   04068 FoxO signaling pathway
    101486997 (mapk1)
   04150 mTOR signaling pathway
    101486997 (mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101486997 (mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101486997 (mapk1)
   04210 Apoptosis
    101486997 (mapk1)
   04218 Cellular senescence
    101486997 (mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101486997 (mapk1)
   04520 Adherens junction
    101486997 (mapk1)
   04540 Gap junction
    101486997 (mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101486997 (mapk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101486997 (mapk1)
   04621 NOD-like receptor signaling pathway
    101486997 (mapk1)
   04625 C-type lectin receptor signaling pathway
    101486997 (mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101486997 (mapk1)
   04912 GnRH signaling pathway
    101486997 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    101486997 (mapk1)
   04916 Melanogenesis
    101486997 (mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101486997 (mapk1)
   04270 Vascular smooth muscle contraction
    101486997 (mapk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101486997 (mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101486997 (mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101486997 (mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101486997 (mapk1)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101486997 (mapk1)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101486997 (mapk1)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101486997 (mapk1)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101486997 (mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 101486997
NCBI-ProteinID: XP_004555701
UniProt: A0A3P9D0P5
LinkDB
Position
LG12
AA seq 369 aa
MATAAVSAPTGSGPSPGPGTELVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRENKIRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFQET
ARFQPSFRS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtgtctgccccaactggcagcggccccagccccgggccgggaacg
gagctggtccgcgggcaggccttcgacgtcgggcctcggtacagcaacctctcctacatc
ggcgaaggcgcctacgggatggtgtgctctgcctacgaccgggagaacaagatacgcgtg
gccatcaagaagatcagcccctttgagcaccagacctactgccagcgaaccctgagagag
atcaaaatccttctgcgcttcaagcacgagaacattatcggaatcaacgacattatccgt
gcaccgaccatcgagcagatgaaggatgtatatattgtccaggatctaatggaaacagat
ctgtacaagctcctgaagactcaacacctgagcaatgaccacatctgctacttcctctac
cagatcctgcgagggctcaagtatatccactctgccaacgtactacaccgtgacctgaag
ccttccaaccttctgctcaataccacctgtgatctcaagatctgtgactttggtttggct
cgtgtggctgatcccgaccacgatcacactggtttcctcacagagtacgttgccactcgt
tggtaccgagctcctgagatcatgctcaactcaaagggctacaccaagtccatagacatc
tggtcagtgggttgcatcctggctgagatgctgtccaacaggccaatctttccggggaag
cattacttggatcagcttaaccatattttgggaattctgggttctccctcacaggaggat
ctcaactgcatcatcaacattaaagccaggaactatctcttgtcactgcctttgcgctgc
aaagtgccgtggaaccgtctctttcccaacgctgatccaaaagctctggacctgctggac
aagatgttgacctttaaccctcacaagaggatcgaggtggaggaggcgctggcacacccc
tacctggaacaatactacgaccccacagatgagcctgttgccgaggccccatttaagttt
gacatggagctagatgacctacccaaagagacgctgaaggagctcatctttcaagaaact
gcacgtttccagcccagctttaggtcctaa

DBGET integrated database retrieval system