KEGG   Maylandia zebra (zebra mbuna): 101474553
Entry
101474553         CDS       T02814                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04110  Cell cycle
mze04115  p53 signaling pathway
mze04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101474553
   04068 FoxO signaling pathway
    101474553
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101474553
   04115 p53 signaling pathway
    101474553
   04218 Cellular senescence
    101474553
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101474553
NCBI-ProteinID: XP_004544851
UniProt: A0A3P9BXJ7
LinkDB
Position
LG5
AA seq 169 aa
MCRVMASHKRILGVLRKRPARRNLFGPVDREQLQVEYQAAMRSDLQEASKRWGFDFSLDK
PLESSDFQWEGVPSTRVPLLYRSCLQDLGQAEGQRSAATVTPKRGRVETAQSEKENIPGT
PGKCTHSQEMLEKTPEKGENTGLKRKQTNITDFYQAKRRVVWMPRKSGE
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtgtagagtgatggcttctcacaagcgaatcttgggggttctgagaaaaagaccagcc
cggagaaacctgtttgggcctgtggaccgagagcagctacaggtggagtaccaggctgcc
atgcgtagcgaccttcaggaggcttcaaagcggtggggctttgactttagcttggacaag
cctctggagagcagtgatttccaatgggaaggtgtcccgagcactagggtgcctctgctc
tacaggtcctgtttgcaggatctcggacaagctgaaggccaaaggtcagcagcgacagtt
actcccaagagagggagggtggagacggcacagagcgagaaggagaacatccccggtacg
ccggggaaatgcacgcacagccaggagatgctggagaaaacaccggagaagggcgagaac
acggggctgaagaggaagcagacgaacatcacagatttctaccaggctaaaagaagagta
gtgtggatgccccgcaaatccggcgagtga

DBGET integrated database retrieval system