KEGG   Maylandia zebra (zebra mbuna): 101474689
Entry
101474689         CDS       T02814                                 

Gene name
nrg4
Definition
(RefSeq) pro-neuregulin-4, membrane-bound isoform
  KO
K05458  neuregulin 4
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101474689 (nrg4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101474689 (nrg4)
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101474689 (nrg4)
SSDB
Motif
Pfam: DUF3149 EGF Laminin_EGF Connexin EGF_2 TRP DUF5385 Phage_holin_6_1 Herpes_gE DUF3169 EphA2_TM DUF3377 DUF2207 PspB LapA_dom Baculo_11_kDa DcuC Cytomega_TRL10 DUF5305 DUF4083 FeoB_associated DUF5803 DUF5849 ArsP_1 Orf78 Bap31 TMEM154 WSS_VP SIT TEX29 AsmA MFS_1_like EGF_MSP1_1 Syndecan hEGF
Other DBs
NCBI-GeneID: 101474689
NCBI-ProteinID: XP_004553461
UniProt: A0A3P9D7G7
LinkDB
Position
LG7
AA seq 109 aa
MMSDHGNPCSAEDATYCMNGGTCYKISSMDTLSCVCNPNYKGSRCEQFQLGVTQPISDEA
GLIAAVIVITLLILIVLGFIVYYIRKMRKAKEQRQQNHNQEYWKVQSRA
NT seq 330 nt   +upstreamnt  +downstreamnt
atgatgtcagatcatggaaacccttgcagtgcagaggatgccacctactgcatgaatgga
gggacatgttataaaatatcttccatggacacactttcttgtgtgtgcaacccaaactac
aaaggcagcagatgtgaacagttccagctcggagtcacacagcccatttcagatgaggct
ggtttaattgcagctgtgattgtcattactctccttatcttgatagtgctgggatttatt
gtctactacatacgcaagatgcgaaaagcgaaggaacagagacaacagaaccacaaccaa
gaatactggaaggtacaatcaagagcatga

DBGET integrated database retrieval system