KEGG   Maylandia zebra (zebra mbuna): 101475058Help
Entry
101475058         CDS       T02814                                 

Gene name
nsd2
Definition
(RefSeq) histone-lysine N-methyltransferase NSD2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101475058 (nsd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101475058 (nsd2)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101475058 (nsd2)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101475058 (nsd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H_2 zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 101475058
NCBI-ProteinID: XP_004554816
LinkDB All DBs
Position
LG19
AA seq 1312 aa AA seqDB search
MDSKGSSLPSMPEPANPISMKQPPESLSVRKGRGDMSSDPAMLMDKAAAHLAATLQDSVL
QKMAGHNNHSHDRLKDLTSRMLNGDQDSLPELCTPEPPMFRGAEAPATNGTHQHNCTPHT
EAELTVTIPQVVTQPLFEPCCANGTSLATAAEGTISGTDERQDIKKRRGRTVKPNPQTNL
NPSDIQVEPPGHTNIMEGTEETDEPENRSELKEEVKEQAPLLSRFSVGDLVWTKVSGYPW
WPCMVTTDPELNHHFKQKQKTNGRSGLLYHVQYFGDAPERGYIFEKNMVSFTGEDQYQEL
SRSNKQPASRINHKKTTPSVPRKLQAQWNMGIIQAKEALDMSLDARMANFGFLYDDDGPH
LNLHILEKLKPEQSNKLNQKAENRLSPDLPLQPNSSKSVSGKQGKPVVPQKKKRISKQGH
SPTKTVRRKKTSAADNTSEPVKKGKTKEVSSTNDVSEVASLPVSVPVKKERKKKKRLLTD
AVAEGDQQSNKRSKPSKDAQKQASTSEGPVKKRRRWTKKTDVKDAKEPRKHLKKSKSPLT
DDQEAEKPKRKRKRKQDGMNQATPSKAKKRRSSPCPDPEGSGSEGRPESPSDSLDGTKKG
ERKKEFVCQMCEQAGEDLVPCEGQCCGMFHLHCLDQTLKPDDKLLCQECSTGIHSCFICK
KLEGEVRRCHVPHCGKFYHEACVRLNTLTVFDNKGFRCPLHTCLSCHYGCRTKHKSNKGR
LMRCLRCPVAYHIGDQCVAAGSEMITNTAIICTNHFNAKKGYSHHSHVNVSWCFVCSKGG
QLLCCESCPAAFHPDCLNIAMPDGSWFCNDCRAGKKPKYRDIIWVKLGTYRWWPAEIHHP
RNIPTNIQHLRHEIGEFPVFFFGSKDYFWTHQGRVFPYMEGDRGSKHQRNGIGKVFKNAL
LEAETRFKEIKIKREAKEAQENSRKPPPYKFIKVNKPVGKVQVYTADISEIPKCNCKPSG
ERPCGFESECLNRMLQYECHPQVCPSGERCCNQDFTKRLYPETKIIKTPGKGWGLICLRD
IKKGEFVNEYIGELIDEEECRARIKYAHENNITDFYMLTIDKDRIIDAGPKGNYSRFMNH
SCQPNCETQKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGAPNCSGFL
GDRPKNSNGQTAEPKGKRLKRKYKKRKSEGKKKSEDECFRCGDGGQLVLCDKKTCTKAYH
LSCLNLTKRPFGRWDCPWHHCDVCGKNSEAFCQLCPNSFCKAHQEGALRPWPPTGQLCCM
EHEELEGGDSHTQDIDSETKTAAAVSRSSKSSKKAEGAEGKTKGSKRKAADT
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atggatagcaaaggtagctccctgccttcaatgcccgaaccagccaatccgatcagcatg
aagcaaccaccggagtccctcagtgtacggaaaggtcgaggggatatgagtagtgaccct
gctatgctaatggacaaagctgctgcacatctggctgccacactacaagacagcgttctt
cagaagatggctggccataacaaccacagtcacgacaggctcaaagacctcacctcccgc
atgctcaacggtgaccaagactcactgcccgagctttgtacccctgagccacctatgttc
aggggtgccgaagcgcctgccacaaatggcacccatcagcacaactgtactcctcacact
gaagctgaactaacagtaacgataccccaagtagtcacgcagccgttatttgagccatgt
tgtgccaatgggaccagtttggccacagccgctgaaggtactatatctggaaccgatgag
aggcaggatataaagaaaaggagggggcgaactgtcaaaccaaatcctcaaacaaactta
aatccctctgacatccaagtggagcctcctggccacacaaacattatggagggaactgaa
gagacagatgagcctgagaacaggtcagagttgaaagaggaagtaaaggaacaggctcct
ttgctgagccgcttctccgttggggatctggtttggacaaaggtgtcaggatacccctgg
tggccctgcatggtgaccacagacccagaactgaaccatcactttaaacagaaacagaaa
accaatgggaggtcaggtctcctttaccacgtgcagtattttggagatgccccagagaga
ggctacatctttgagaagaacatggtgtccttcactggtgaggatcaataccaagagctt
agtcggagcaacaaacagccggcctcgcgtatcaaccataaaaagacaactccctctgtg
ccgcgtaaactccaggctcagtggaacatgggcatcattcaggccaaggaggcactcgac
atgtccctggatgctcgcatggccaactttggatttctgtatgatgacgacgggcctcat
ctgaacctccacatcttggagaagttaaagccggaacaaagcaacaagctgaaccagaaa
gcagagaataggcttagcccagatctccccctccaaccgaattcctcaaaatctgtatca
ggtaaacaaggtaaaccagttgtacctcagaagaaaaagagaatatccaaacagggtcac
tctcccaccaagacagtgaggagaaagaaaacgtctgcagcggacaacacttctgagccc
gtgaagaaggggaaaacaaaggaggtctcttcaacaaatgatgtttcagaagtggcctca
cttccagtttcagttccagtgaaaaaggagcgaaagaagaagaaaaggctgttaacagat
gctgtggcagaaggggatcagcagtctaacaagagatccaaaccaagcaaagatgctcaa
aaacaggcttcaacttcagaaggaccggtgaaaaagcggagaaggtggacaaagaaaacc
gacgtaaaggatgcaaaagaacccaggaaacatctgaagaagtcaaaaagtcccctgact
gatgaccaagaggcagagaaaccaaagcgcaagagaaaaaggaaacaggatggaatgaat
caggccacaccctccaaggcaaagaagaggcgttcctccccgtgtcctgatcccgagggt
tctgggagtgaaggacgccctgaatctccgagtgacagcttagacgggacaaagaagggt
gaacgcaaaaaagagtttgtctgtcagatgtgtgagcaggctggtgaggacctggtaccc
tgtgagggtcagtgctgcgggatgttccacctccactgtctcgatcagactctcaaacct
gacgacaagctgttgtgtcaggagtgtagcacaggaattcactcgtgtttcatttgtaag
aagttggagggtgaggtccggcgctgccacgtcccacactgcggcaaattttaccacgaa
gcgtgtgtccgcctcaacaccctcacggtgtttgacaacaagggcttccggtgcccgcta
cacacctgcctgagctgccactacggctgccgcacaaagcacaagtccaacaaaggcagg
ttgatgcgatgccttcgatgcccagtagcgtaccacatcggcgatcagtgtgtggctgca
ggaagtgagatgatcaccaacactgccatcatctgcaccaaccacttcaacgccaagaag
ggctacagccaccacagccatgtcaatgtcagctggtgcttcgtctgctccaaaggggga
cagctgttgtgctgtgagtcctgcccggcagcttttcaccctgactgcctgaatatcgct
atgccggatgggagctggttctgcaacgactgccgagctggaaagaaacccaagtacagg
gacatcatctgggtcaaactgggaacataccgatggtggccagcagagatccaccaccca
agaaacattcccaccaacatccagcatcttcgacacgagatcggagagttcccagtcttc
ttctttggctccaaggattatttctggactcaccagggcagagtatttccatacatggaa
ggcgacaggggaagcaaacatcagaggaatggaattggcaaagtcttcaagaatgctctg
ctggaggccgaaactcgatttaaggagataaagataaagcgagaggctaaggaagcgcag
gagaacagccgtaaacctcccccatataaatttatcaaggtcaacaaacctgtcggcaag
gttcaggtgtacaccgcagacatttctgagatccccaaatgtaactgcaagccatctggc
gagcggccgtgtgggtttgagtcggagtgcttgaaccgcatgctgcaatacgagtgccac
cctcaggtgtgtcccagtggggagcgctgctgtaaccaggacttcaccaaacgtctgtat
ccagagaccaagattatcaagacccccggcaaaggttggggcctgatctgcctgcgcgac
atcaagaagggtgagtttgtgaacgagtacattggagagctgatcgacgaggaggagtgc
agggcgagaatcaaatacgcccatgaaaacaacataaccgacttctacatgctcaccatc
gacaaggaccgaatcatcgacgctggcccgaaaggaaactactctcgcttcatgaaccac
agctgtcagcccaactgtgagacacagaagtggacggtgaatggtgacacgcgtgtcggc
ctgttcgccgtctgcgacatcccagcaggcaccgagttgacttttaactacaaccttgat
tgtctcggcaacgagaagaccgtgtgccgctgcggcgcgcccaactgcagcggatttctt
ggtgaccgaccgaagaactcaaatggccaaacagctgagccaaaaggaaagaggttgaag
agaaagtataaaaagaggaaatcggagggaaagaaaaaatctgaggacgagtgtttccgc
tgtggagacggagggcagctggtgctctgcgacaagaagacctgcaccaaagcttatcac
ctgtcctgcctgaacctcaccaagagaccgttcggccgctgggactgcccctggcatcac
tgtgacgtctgtgggaaaaactctgaagccttctgccaactctgccccaactctttctgc
aaggctcaccaggagggggcgctgcgtccctggccccccacaggacagctgtgttgtatg
gagcacgaagagctggagggaggcgacagccacacccaggatatcgactcggagacgaaa
acggccgccgccgtcagtcgttcctctaaaagctccaagaaggcggagggagcagagggc
aaaacaaagggctccaagagaaaagccgcagacacctga

DBGET integrated database retrieval system