KEGG   Maylandia zebra (zebra mbuna): 101475377
Entry
101475377         CDS       T02814                                 

Gene name
abl1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101475377 (abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101475377 (abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101475377 (abl1)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101475377 (abl1)
Protein kinases [BR:mze01001]
 Non-receptor tyrosine kinases
  ABL family
   101475377 (abl1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 101475377
NCBI-ProteinID: XP_012772175
UniProt: A0A3P9CRZ9
LinkDB
Position
LG7
AA seq 1104 aa
MGQQPGKLVGDQRRPSLPAFIKGSKKESSRHGNQPCNVFAVHEALQKPEIEGQGLTEAAR
WNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNG
QGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRY
EGRVYHYRINTASDGKLYVSSDSRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYG
VSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYNLTVAVKTLKEDTMEVEEFLKEA
AVMKEIKHPNLVQLLGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLHMATQI
SSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMIGDTYTAHAGAKFPIKWTA
PESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMDRPEGCPEK
VYELMMACWKWNPSERPTFAETHQAFETMFQESSISDEVEKELGKKGKKTLGSIQQAPEL
PTKTRPRKSNIDSRDTESPDLLETEGAVSSPMLPRKERPPLDSNLNEDDRLLPKDKDKTR
GFLSLIKKKKKSAPTPPTRSSSFKGDCLSDRRCVTQDPRDSDIFNNGASLGINDAIHGLH
STNNNGAAGITNGAPTYPVPSCPRKKLPLVVTSPGGKGATTPPSEEEPFSNSRFFWSMPT
GSDGTECKSVTLPRDLSHRRFDTGTVGGKPALPRKQQKGENAPRMGTLTPPPRLNTSPDI
SSTFLGRDNDLSPGSSPKALTPKVVKRPSVSGPESSKTSALHAELLKPNVFPPMGAAGEE
CRARRNKHTEFSSSRDRVKIQKPKPAPPPPPTNAKTGKVSRSPTQELPSPTASEIKAKCL
PSISDPHHTATPSDQARLPLSEASKKLPLGSTSKPQPLKTSASSTSVTSSPSSQSLGGLS
SPLTSPNDPNSPTAFTPLAKTRSSLRKTAPRQASERTPNSAVTREMVLEGTELLRAAISR
NSEQTGSHSAVLEAGKNLSKYCVSYVDSIQQMRNKFAFREAINKLESSLRELQICPNATG
GSSAQQDFSKLLSSVKEISDIVQR
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggggcagcagccggggaagcttgtaggggaccagaggagacccagtttgccggccttc
atcaagggctcgaagaaggaatcatcacgccatgggaaccagccctgtaatgtttttgct
gtgcacgaagctctccagaagccagaaattgagggtcagggtctgacagaagcagcccgc
tggaactccaaagagaaccttttggctggacccagtgagaatgaccccaacctgtttgtt
gccctctatgattttgtggccagtggtgacaacactttaagcattactaaaggggagaag
ctgcgtgtgctgggttacaatcataacggcgagtggtgtgaagcacagaccaagaatggc
caaggttgggtgccgtccaactacatcaccccagtcaacagcctggagaagcacagctgg
taccatggacccgtgtcacggaacgcggcagagtatctgctcagctcgggcatcaacggg
agctttctggtccgtgaaagcgaaagcagccccggtcagaggtccatttctctgcggtat
gaggggagagtgtaccattacaggattaacactgcgtctgatggcaagctttacgtctca
tctgacagccgtttcaacacactggccgagctggtgcaccaccattccaccgtggccgac
ggcctcatcacgacactgcactacccagcgccgaagcgtaacaagcccaccatctatgga
gtttctcccaactacgataagtgggagatggagcgcactgacattaccatgaagcacaaa
ctaggagggggccagtatggggaagtgtacgaaggcgtttggaagaagtacaacctcacc
gtggcagtcaagacgttaaaggaggatacgatggaggtggaggagtttctgaaggaggct
gcggttatgaaagagatcaaacaccctaacctggtgcagctgttaggcgtgtgcacacgg
gagcccccgttctacatcatcacagagttcatgacccacggtaacctgctggactacctg
agggagtgcaacagagaggaggtcaatgctgtggtgctgctacacatggccacacagatc
tcctctgccatggaatacctggagaaaaaaaactttatacacagggacttggcagcccgt
aactgtctcgttggggagaaccacctggtgaaggttgcagattttggcctgagcaggctg
atgattggagatacctacacggctcatgccggggccaagttcccgatcaagtggacagct
ccagagagtctggcttacaacaagttctcgattaagtctgatgtctgggcatttggtgtg
ctgctgtgggagattgccacatatggcatgtctccttaccctggcatcgacctgtcccag
gtctatgaactgttagaaaaagactatcgtatggatcgaccagagggctgccccgagaag
gtctatgagctcatgatggcctgttggaagtggaacccttcagaacgtccaacttttgct
gaaacccaccaagcctttgagaccatgttccaggaatccagcatctctgatgaggtggaa
aaggagttgggaaagaaaggaaagaagacattaggctccatccagcaggctccggagctg
cccaccaagaccagacctcgcaagagcaacatagacagccgagatacagagagcccagat
ctgttggaaacggagggggctgtgtcgtcacccatgctccccaggaaagagcgccccccc
ctggacagcaacctgaatgaggacgatcgcttgctgcccaaggacaaggacaagacgcgt
ggctttctcagcctcatcaagaaaaagaaaaagagtgcgccaactcctcccacacgcagc
tcctcttttaaaggagactgcctctctgacaggaggtgcgttactcaagatcctcgagac
agtgacatctttaacaacggggcatcattgggcattaatgacgccatacatggcctccac
agtacgaataataatggagcagcaggtataactaatggggctcctacctacccagtacct
tcttgccctagaaagaagttacctcttgtagtgactagcccaggtggaaagggagcaaca
actccacctagtgaggaggaacccttttctaactctaggtttttctggtccatgcccact
ggctcagatggcacagaatgtaagtctgtcacactgccgcgagatctgagccatcgccgc
ttcgacacaggcaccgtcgggggcaagccagctctgccacgaaagcagcagaaaggagag
aatgcgccacggatgggcaccctgactcccccaccacgcctgaatacatctccagatatt
tcatccaccttcttaggcagagataatgatctcagtcctggttccagtcccaaggctttg
acacctaaggtggtgaagagacccagtgtgtcagggccagaaagctccaagaccagcgct
ctgcatgccgagcttctgaagcccaatgtgttccctcctatgggagcagctggagaagaa
tgcagggctcgcagaaacaagcacacggagttctcctccagcagggatcgagtaaaaata
cagaaacccaagccagccccacctccaccacccactaatgcaaaaacgggcaaggtctcc
cgcagccccactcaagagctcccctccccgactgcttcagaaatcaaagctaagtgcctc
ccttccatctcagatccccaccacacagccactcccagtgaccaagcccgcttacccctg
agtgaggcctccaagaagctgcccttgggctccacctctaaacctcaaccgttaaagacc
tccgcctcttccacttcagtaaccagctccccctccagccagagccttggaggtttgtct
tctcccctcacctcccccaacgatccaaattcacctactgcattcacccctctagcgaaa
acccgatcctccctccgcaagactgcaccccgccaggcctccgagcgcactccaaactca
gccgtgacacgcgaaatggtgctggagggcaccgagctgctccgcgccgccatttcccgc
aactccgagcaaacgggtagccacagcgccgtgctggaggccggcaagaacctgtcaaag
tactgcgtgagctatgttgactccattcagcagatgaggaacaagtttgcctttcgcgag
gccatcaacaagcttgagagcagcttgcgagagcttcagatctgccccaatgccacgggg
ggctcgagtgcacagcaggacttcagcaagctgctgtcctccgtcaaagagatcagtgac
attgttcagaggtag

KEGG   Maylandia zebra (zebra mbuna): 101486332
Entry
101486332         CDS       T02814                                 

Gene name
abl2
Definition
(RefSeq) Abelson tyrosine-protein kinase 2 isoform X1
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101486332 (abl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101486332 (abl2)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101486332 (abl2)
Protein kinases [BR:mze01001]
 Non-receptor tyrosine kinases
  ABL family
   101486332 (abl2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6 Kinase-like
Other DBs
NCBI-GeneID: 101486332
NCBI-ProteinID: XP_004555137
LinkDB
Position
LG23
AA seq 1203 aa
MGQQVGRVGEGTSTGLQPPQPHAPQPHQGKGNRGSGVGRRPREPGSSTGTPPGRTAPVNV
PDPGINIFTQHSEALTEAVRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKL
RVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGS
FLVRESESSPGQLSISLRYEGRVYHYRINTATDGKVYVTSESRFATLAELVHHHSTVPDG
LVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYNLTV
AVKTLKEDTMEVEEFLKEAAVMKEVKHPNLVQLLGVCTLEPPFYIVTEYMPHGNLLDYLR
ECERDEVNAVALLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLM
TGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQV
YDLLEKGYRMEQPEGCPPKVYELMRACWQWSPLDRPSFAEIHQAFETMFHGSSISEEVAE
ELCKTASSDHSGPLQSFSHDMPLLPSKSRPLHKHTENKENIEGGLDGRTDHCTHGHSGWA
SSLLGGDGRSGTSPALPRKQQSRDKSPSSLLEDAQDVGTFTRDRKTGFFSSFIKKKSSSS
QSSQHQQNLPMPPKRSSSFREMETQPHKKYEPTPDFSAPPPLPQSDSLGGFSASPSHSHG
EPIQAQSRCCGAAFGQKPSGGGFGSQVTSGSSWSGLAGFFTPRLIKKTLGLRTGKTCSAD
EGGNIVGGPKPFPRSNSTSSMSAGLPDLERMALTLPRNRSAKPPLERTASTTSQPENGAA
RPSETLLRRMDEGTAQIRERPKAKLLPRGTAVGVRAPGVGGEVGDSDSLSRVREGREESG
GLDRQQSWTSPSKCSGLSMSSAAAGGPTHNHKVPVLISPTLKHSPGDVHLVGLDSQGNRF
KLLSEHQADRDKPRLVKPKCAPPPPPTLRSLQHSYSGDGEEQVGGMPVEVNGDTLKGQRS
GRMSGGMMTGRPSVPPPQVPPASSFSSSCSATTNTTPTKMANGATTTAPSHTALSAGSKV
ALRRTRQQVERAPLERVSREALLDCAECLSSALHASSESPSSSQVLDAGHQLLDYCSGYV
DCIPQMRNKFAFREAVGKLELSLQELRASSSGGGGLGGVGSNTVLDNLHGCIKEISDVVQ
RFC
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgggacagcaggttggccgagtcggtgagggtacatcgaccgggctccagccaccacag
ccccacgcgccccaaccacaccaagggaaggggaaccgggggagcggcgtcgggaggaga
ccccgggaacccggcagtagcaccgggacaccgccaggcaggacagctccagtcaatgtg
cccgatccaggcatcaatatattcacgcagcattcagaagctctgacagaggcggtgcgc
tggagctccaaggagaaccttctgggcgcgaccgagagcgaccctaacctctttgttgca
ctttatgactttgttgctagtggagacaacacactcagcatcaccaaaggtgagaagctg
cgtgtgctgggctacaaccagaatggagagtggagtgaagtgaggtctaaaaacggtcag
ggatgggttccctccaactacatcacaccggtcaacagcctggagaagcatagctggtac
cacgggcccgtttcccgcagcgctgcagagtatctgctctcatcacttatcaatggcagt
tttctggtgcgagaaagcgagagcagccccggacagctgtccatatctctgcgctatgag
ggcagagtgtaccactaccggatcaacacagccacggatggaaaggtgtacgtaacatcc
gaaagccgcttcgccactctggccgagctggtccatcaccactccactgtacctgatggt
ctggtcaccacgctgcactaccctgcacccaaatgtaacaagcctacagtgtacggtgtg
tcacccatccatgataagtgggagatggagcgcacagacatcaccatgaagcacaagctg
ggaggaggccagtatggggaggtgtatgtcggagtgtggaaaaagtacaacctcactgtg
gctgtcaaaacactaaaggaagacaccatggaagtagaggagtttttgaaagaggcagca
gttatgaaagaggttaaacacccaaacctcgttcagctgctgggtgtgtgtacgttagag
cctcctttctacattgtgaccgagtatatgccacatggcaacctactggactacttgaga
gagtgtgaacgcgatgaggtgaatgctgttgcgctgctatacatggcaacgcagatctcc
tctgccatggagtatctggagaaaaagaactttatacacagggatctcgcagcaaggaac
tgcctggtcggtgaaaatcatgtcgtgaaggttgccgatttcggcctgagccggttgatg
accggtgacacctacaccgcccacgctggggccaagttccccatcaaatggaccgcaccg
gagagccttgcctacaacaccttctccatcaagtctgatgtctgggcttttggagtgcta
ctttgggaaattgccacttatggcatgtctccctacccgggtatcgatttgtctcaggtc
tacgatctcttggagaaaggctatcgcatggagcaacctgagggatgcccgcccaaagtt
tatgagctgatgagggcatgctggcagtggagcccgttggatcgaccttcgtttgcagag
atccaccaagccttcgaaacgatgtttcacggctcgagcatttctgaagaggtggcagag
gagctctgtaagacagcatcctctgatcacagcgggccgctgcagtctttcagtcatgat
atgcccctgttgccttccaaatctcgcccactccacaagcacacagaaaacaaggaaaac
atcgagggtggactggacggccgcaccgaccactgcacgcacggtcactcaggttgggcg
tcatctttgctcggaggggacggccgatcaggcacctccccagccctccccagaaagcaa
cagtcaagagataaatctcccagcagccttttagaggatgcacaggatgtgggcacattt
acacgagaccgcaagactggcttctttagctcatttatcaaaaagaaatcttcctcgtca
cagtcttctcagcaccaacagaaccttccgatgccacccaagagaagcagttccttccgg
gagatggagacacaacctcacaaaaagtacgagcctacacccgatttcagtgctcctcct
cccctgccccagtcagacagtttagggggcttctctgcgtctccttcccactcacatggg
gaacctatccaggcacagtctcgctgctgcggggcagcttttggacagaaaccctctggg
ggaggctttggttcacaggtgacaagtggtagcagttggagtgggctggctggctttttt
acccctagactcattaaaaagaccctggggctacggacaggaaagacatgctccgcagac
gagggtggaaatatagttggtgggcctaaacctttccctaggtccaattctacctcgtca
atgtcagctgggctgcctgatttggagcgcatggctctgacgttacccaggaaccgcagt
gctaaaccgcctctggagaggactgcctcaacaacctctcagccagagaacggggctgca
cgaccgtcagaaactctgctgaggaggatggatgaggggactgcacagatcagggaaagg
cccaaagccaagctactaccccggggcactgctgtaggggtgagggcaccgggggtcggg
ggggaagttggggattcggacagcctgtcccgagtcagggagggtagagaggagagtgga
ggactggacaggcagcagagttggacatctccctccaagtgctcgggcttgagcatgtca
tcagctgcagcaggtgggccgactcacaaccacaaagtcccagtgctgatctctcccaca
ctgaagcacagcccaggtgacgtgcacctggtcgggctagactctcaggggaaccgcttt
aaactgctgtctgagcaccaagcagaccgagacaagccacgcctcgtcaaacccaagtgt
gcgccgccgcctccccctactctgcgcagtctgcaacactcctacagcggcgacggagaa
gagcaagtcggaggaatgcccgtggaagtaaatggggacacattaaaaggtcaaaggtca
gggcgaatgtcaggaggaatgatgacaggcagaccatcagtgccaccaccgcaagtgcct
ccagcttcttccttttcttcttcttgctctgccaccacaaacacaacgcccactaaaatg
gccaatggggcgaccaccactgccccctcgcacacagcactgtctgctggttccaaagtg
gcactgcggcgaactaggcagcaagtggagagggcgcccttggagcgggttagccgcgag
gccttgctggactgcgcggaatgcctgagcagcgcactccacgccagctccgaaagcccc
tccagcagccaggttctggacgctggccatcagctgctagactactgctcaggttatgtg
gactgcatccctcagatgaggaacaagtttgcctttcgagaggcagtggggaagctggag
ctcagcctgcaagaactgagagcctcgtcgtcaggaggtggggggttgggtggcgtgggg
tccaacactgtactggataacctacacggctgtattaaagagattagtgacgtagtgcag
aggttctgttga

DBGET integrated database retrieval system