KEGG   Maylandia zebra (zebra mbuna): 101475727Help
Entry
101475727         CDS       T02814                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101475727 (suv39h1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101475727 (suv39h1)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101475727 (suv39h1)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101475727 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101475727 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101475727
NCBI-ProteinID: XP_004570981
LinkDB All DBs
Position
Unknown
AA seq 411 aa AA seqDB search
MAENLKDCSVPCKMSWDELEAMCRMEKLQCQELGVSRANVNEYEVEFLCDYKKTKEEELY
LVKWKGFPESDNTWEPKRNLKCPKLMKQFHLDLDQELRRHKRRCIPKKLDKEVSSFLVQK
AKLRQSLQRWEDHLNHTRNHPGRIFVMNEVDLEGPPKNFTYINNYKVGQGIVLDEMAVGC
ECKNCLEEPVNGCCPGASLQRMAYNDRGQVRIRPGQPIYECNSRCSCGPDCPNRVVQNGI
QFDLCIFKTGNGRGWGVRTLQHIKRNTFVMEYIGEIITTDEAERRGHIYDRQGSTYLFDL
DYVEDVYTVDAAHLGNISHFVNHSCNPNLQVYNVFIDNIDERLPRIALFSTRAIRAGEEL
TFDYKMQIDPVDTESTKMDSSFSLAGLPGSPKKRVRVECRCGSDSCRKYLF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaagattgcagcgtgccctgcaagatgtcctgggatgagctggaa
gccatgtgtcgaatggagaaactccagtgtcaagagcttggagttagcagagccaacgtc
aatgaatacgaggttgaattcctatgtgactacaagaagactaaggaagaggagttgtac
cttgtaaaatggaagggctttccagaatcagataacacttgggaacccaagaggaaccta
aaatgtcccaaactgatgaagcagttccatcttgacttggaccaggagctgaggcgccac
aagcgacgttgcatcccaaaaaagctagataaagaagtttcctcatttctggtccaaaaa
gccaaacttcgccagagtctgcagcgctgggaagaccatctgaatcatactcgcaatcat
ccagggcgcatttttgtcatgaacgaagtggacctagagggtcctccgaaaaactttacc
tatatcaacaactataaagtaggtcagggcattgtgttagatgagatggcagtgggttgt
gaatgcaaaaactgtttagaggagccagtgaatggctgttgccctggggcttccctccaa
cgcatggcctacaacgacagaggacaggtccggattcggcctggacagccaatatatgag
tgcaactcccgctgcagctgtgggcctgactgtcccaacagagttgtgcagaatggcatc
cagttcgatctgtgtatctttaaaacggggaacggccggggatggggagtccgcacactg
cagcacatcaagaggaacacatttgtcatggagtacattggggagattatcaccacagac
gaagcagagagaagaggtcatatatatgatcgccagggctctacgtacctctttgacctg
gactatgtcgaggacgtgtacacagtggatgcagctcacctaggcaacatttctcatttt
gtcaaccacagctgtaaccctaacctgcaggtatacaacgtgttcattgacaacattgac
gaaaggcttccgagaattgcgttattttcaacacgtgctatccgagcaggagaggagctc
acctttgactacaaaatgcaaattgatccagttgatacagaaagcaccaaaatggattcc
agtttcagtctagctgggcttcctggctctccaaagaagagggttcgagtggagtgtcgg
tgtggatcagactcatgtcgaaaatatctgttctga

DBGET integrated database retrieval system