KEGG   Maylandia zebra (zebra mbuna): 101475777
Entry
101475777         CDS       T02814                                 

Gene name
map2k7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X1
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04141  Protein processing in endoplasmic reticulum
mze04530  Tight junction
mze04620  Toll-like receptor signaling pathway
mze04912  GnRH signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101475777 (map2k7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101475777 (map2k7)
   04012 ErbB signaling pathway
    101475777 (map2k7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101475777 (map2k7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101475777 (map2k7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101475777 (map2k7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101475777 (map2k7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101475777 (map2k7)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101475777 (map2k7)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE7 family
   101475777 (map2k7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101475777
NCBI-ProteinID: XP_004539306
LinkDB
Position
LG6
AA seq 439 aa
MSSLEQRLSRIEEKLKQENEEARRRIDLNIDMSPQRSRPRPIIVIQLSPAPAPSQRAALQ
LPLANDGGSRSSSSESSPQHHPYPSRPRHMLTLPTPPYGLQKSLENAEIDQKLQEIMKQT
GYLKIDGQRYPAEVTDLFSEGEIGSGTCGQVFKVRFKKTGHVIAVKQMRRTGNKDENKRI
LMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPERILGKMT
VAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAY
MAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLL
PLGMGFSLDFQSFVKDCLTKDHRKRPKYHQLLEHSFIRRYEVLDVDVAGWFQVVMDRTES
PRSSQCYSHQHQLHSLFSR
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcgtcgctggaacagaggctgtcgcgaatcgaagagaaactaaagcaggagaatgaa
gaagctcgccggagaatcgacctcaacatcgacatgagtccacagcggtcacgaccgagg
ccgatcatcgtgatccagctcagtcctgctccagccccttcccagcgtgcagcgctccag
ctgcccctggctaacgatggaggcagccgttcgtcatcttcagagagctcgccccagcac
cacccgtaccccagccgcccacgacacatgctaaccctgcccacgcctccgtatggccta
cagaagagcctagagaatgcagagattgaccagaaattgcaggagatcatgaaacagacg
ggttatttgaagatcgacgggcagcggtatccagcagaggtaacagacctgttcagcgag
ggggagatcggcagcgggacttgtggacaagtcttcaaagtgcgattcaagaagacgggc
catgtcattgcggtcaaacaaatgcgtcgcacaggaaacaaagacgagaacaagcggatc
ttgatggacctggacgtggtgctgaagagtcatgactgcccttacatcatccagtgctac
ggcgccatagtgaccaacacggatgtattcatcgccatggagctgatgggaacttgtgct
gagaagctaaagaagagaatccagggtcccatcccagagcgaatcctcggaaagatgacg
gtggcaatagtgaaagcgttgctgtacctgaaagagaaacacggcgttatccaccgggac
gtcaaaccctctaacatcctgttagacgctaaaggtcagattaaactgtgcgacttcggc
atcagcggacgcctcgtcgactccaaggccaagacccgcagcgccggctgtgctgcctac
atggcacctgaaagaatagaccctccagatcccaccaaacctgactatgacatccgggca
gacgtgtggagcctcggcatctctctggtggagttggctacaggacagtttccctacaag
aactgcaagacagactttgaggttctgaccaaagtgctgcaggaggaccctcctcttctg
cctctcggcatgggtttctccctcgacttccagtcctttgtcaaagactgcctcacaaag
gatcacagaaaaaggccaaaataccatcagctgctggagcatagtttcattcggcgttac
gaggtgctcgacgtagacgtggctggttggtttcaggtggtgatggatcgcaccgagtcg
cctcgcagcagccagtgttacagccatcagcatcaactccactcgctctttagtaggtag

KEGG   Maylandia zebra (zebra mbuna): 101478377
Entry
101478377         CDS       T02814                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04620  Toll-like receptor signaling pathway
mze04912  GnRH signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101478377
   04012 ErbB signaling pathway
    101478377
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101478377
  09152 Endocrine system
   04912 GnRH signaling pathway
    101478377
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101478377
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101478377
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101478377
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE7 family
   101478377
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase APH
Other DBs
NCBI-GeneID: 101478377
NCBI-ProteinID: XP_004569733
LinkDB
Position
LG8
AA seq 421 aa
MATPSPNSNSTSSSNNSNIVGSTSHQLHQQTQSSSMQETNTCWRCQNETGFQISLSGIPQ
SKRKALKLNFANPPVKPASRLPLNPTVPSFQNPHIERLRTHSIESSGKLKISPEQHCDFT
AEDLRDLGEIGRGAYGSVNKMVHKPTGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDC
PYIVQFYGALFREGDCWICMELMSTSLDKFYKYVYCALDDVIPEEILGKITLATVKALNH
LKENLKIIHRDIKPSNILMDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPS
ASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGEPPQLSNSEERQFSP
KFTNFVNLCLTKDESKRPKYKELLKHPFILMYEERFVDVASYVCRILDQIPASPISPMYV
D
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcgactcccagtcctaacagcaactccactagctctagcaacaacagcaacatcgta
ggatcaacgtcgcaccaactccaccagcaaacacagagcagcagcatgcaagaaaccaac
acctgctggagatgtcaaaatgaaacagggtttcagataagcctgtctggaataccccaa
agtaaacgcaaagctctgaaactgaattttgccaaccctccagtgaaaccggcttccagg
ctcccactcaatccaacagttccctctttccagaaccctcacatagagcgcctacggaca
cacagtattgagtcatctgggaagctgaagatctcccctgagcagcactgtgacttcact
gcagaggatctgagagaccttggtgagatcggccgtggggcgtatggctccgtcaacaag
atggtccacaaacccacaggccagatcatggctgtcaagaggattcgctccactgtggat
gagaaggagcagaagcagctgctgatggaccttgatgtagtgatgaggagtagtgactgt
ccctacattgtgcagttctacggcgccctcttcagggagggggactgttggatttgtatg
gaacttatgtctacctcattagacaaattctacaaatatgtatattgtgcattagatgac
gtcattccagaggaaatattaggcaaaataacattagcaactgttaaagcactgaaccac
ttaaaagaaaacttgaaaataattcacagagacatcaaaccttccaacattcttatggac
cgaaaggggaatatcaaactgtgcgattttggcatcagcggccagctggtggactccata
gccaagaccagagatgcaggctgcaggccttacatggcacctgaaaggatagaccccagt
gcttctagacaaggctatgatgtccggtctgatgtatggagtttgggaatcaccctgtat
gagctggcaacaggaagattcccctaccctaagtggaatagtgttttcgatcagctgacg
caggtggtaaaaggtgagcctccccagctcagcaactcagaggagaggcagttctccccc
aagttcaccaactttgttaacctatgccttacaaaggatgaatcaaaaaggccaaagtac
aaggagcttctgaaacaccctttcattctgatgtatgaggagcgttttgtggacgttgcc
agctatgtgtgtcgcattctggatcagatccctgcctctcctatctcgcccatgtatgtc
gactga

KEGG   Maylandia zebra (zebra mbuna): 101483027
Entry
101483027         CDS       T02814                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04620  Toll-like receptor signaling pathway
mze04912  GnRH signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101483027
   04012 ErbB signaling pathway
    101483027
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101483027
  09152 Endocrine system
   04912 GnRH signaling pathway
    101483027
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101483027
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101483027
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101483027
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE7 family
   101483027
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH CitX Choline_kinase
Other DBs
NCBI-GeneID: 101483027
NCBI-ProteinID: XP_004556429
UniProt: A0A3P9AT13
LinkDB
Position
LG4
AA seq 426 aa
MEFKHTTMATPSPNNSTTPSSNNAGAHQQSQSQHITTMSSMQESNTCWRCQSETGFQINL
SGAPPSKRKALKLNFANPPIKPMTRFTLNTAGPPFQNPHIERLRTHSIESSGKLKISPEQ
HWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSNQIMAVKRIRSTVDEREQKQLLMDLDVVM
RSSDCPYIVQFYGALFREGDCWICMELMATSLDKFYKFVYGSLDDVIPEEILGKITLATV
KALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPE
RIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVRGDPPQLSNSEE
RRFSPKFIAFVNVCLTKDESKRPKYKELLRDPFIQMYEERSVDVAGYVCRIMDQMPASPS
SPMYMD
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggaattcaaacacacaacaatggcgactcccagccctaacaactcaacaacacccagc
agcaacaacgcaggagcacaccagcagtcccagtcccagcacattaccaccatgagcagc
atgcaggagtccaacacctgctggagatgtcagagtgaaacagggtttcagataaacctg
tctggagctcccccaagtaaacgtaaagccctgaagctgaactttgccaatcctcccatc
aaacccatgactagattcacactgaacacggccgggccgcccttccagaaccctcacata
gagaggctgaggacacacagcatcgagtcctcgggaaaattgaagatctccccagagcag
cactgggacttcacagccgaagatctcaaagatctgggcgagatcggccgaggagcttac
ggctccgtcaacaagatggtgcacaagccgagtaaccagatcatggcggtcaagaggatt
cgatcaacagttgatgagagagaacagaagcagctgttgatggacttggacgtggttatg
agaagtagtgattgtccttacatcgtgcagttttatggtgctctgttcagagagggggac
tgctggatttgtatggaacttatggctacctcgttagacaaattttacaagtttgtatat
ggctcattagatgatgtgattccagaagaaatattaggaaaaataactttagctactgtg
aaggcgcttaaccacttaaaagaaaacttgaaaattatacacagagacattaagccgtca
aacatcctcctggacaggaacggcaacataaagctgtgtgactttggcatcagcggtcag
ctggtggactccatcgccaaaaccagagatgccggttgcagaccgtacatggcgccggag
agaatagaccccagcgcgtcccggcaaggttacgatgtccgctcagatgtctggagtttg
ggaatcacactgtatgagctggccacgggacggtttccctacccaaagtggaacagtgtg
tttgatcagctgacccaagtggtgagaggagacccgccgcaactcagcaactcggaggag
aggcgcttctcccccaaattcatcgcctttgtcaatgtgtgccttacaaaggatgaatca
aaaaggccaaagtacaaagagctgctgagagatccgttcattcagatgtacgaggagcgc
tcagtcgacgtagccggttacgtctgcaggatcatggatcagatgccggcctctcccagc
tcccccatgtatatggactga

DBGET integrated database retrieval system