KEGG   Maylandia zebra (zebra mbuna): 101476411
Entry
101476411         CDS       T02814                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04137  Mitophagy - animal
mze04144  Endocytosis
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04520  Adherens junction
mze04530  Tight junction
mze04540  Gap junction
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04912  GnRH signaling pathway
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101476411
   04370 VEGF signaling pathway
    101476411
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101476411
   04137 Mitophagy - animal
    101476411
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101476411
   04520 Adherens junction
    101476411
   04530 Tight junction
    101476411
   04540 Gap junction
    101476411
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101476411
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101476411
  09152 Endocrine system
   04912 GnRH signaling pathway
    101476411
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101476411
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101476411
Protein kinases [BR:mze01001]
 Non-receptor tyrosine kinases
  SRC family
   101476411
Membrane trafficking [BR:mze04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101476411
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    101476411
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101476411
  Macropinocytosis
   Kinases
    101476411
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 zf-RING_14
Other DBs
NCBI-GeneID: 101476411
NCBI-ProteinID: XP_004547663
UniProt: A0A3P9B5P4
LinkDB
Position
LG5
AA seq 550 aa
MGAGKSKPKEPGQRSMSLDGTIGTGSDSGHFHHLGPAQQTQTPNRSPAVGTGRRGHQGQH
QHAPTNTPELALFGGVDHTGTVTSPHRGPLSGGVTTFVALYDYESRTASDLTFRKGDRLQ
IVNNTKKYSFREGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLL
NPQNRRGTFLVRESETTKGAYCLSVLDYDNTKGANVKHYKIRKLDSGGFYITSRTQFTSL
QQLVFHYRKHSDGLCHALTDVCPVTKPQTQGLARDAWEIPRESLRLDVKLGQGCFGEVWM
GTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSQ
GSLLDFLKGEAGKLLRLPQLVDMAAQIAAGMAYVERMNYVHRDLRAANILVGDSLVCKVA
DFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPY
PGMVNREVLDQVERGYRMPCPAECPSSLHELMLSCWRKDPEERPTFEYLQGFLEDYFTST
EPQYQPGENL
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgggggcgggcaagagcaagcccaaggagccgggccagcgctccatgagcctggatggt
accataggcacaggctccgacagcgggcacttccaccacctgggacccgcccagcagacc
caaacacccaacaggagccctgccgtcggaacaggcaggcgggggcatcaagggcagcac
cagcacgccccaacaaatactcccgagctggctctcttcggaggagtggaccacacggga
actgtcacatcacctcatagaggacctctgtcaggaggcgtcactacatttgtggctttg
tatgattatgagtcacgaacagcatctgatctgacctttaggaaaggggaccggctgcag
attgtcaacaacacgaaaaagtacagcttcagagaaggggattggtggctcgctcgctcc
ctgacaactggagagagcggttatatccccagcaactatgtggctccatccgactccatc
caagcagaagagtggtattttgggaagatcactcgacgtgactcggagaggctccttctc
aaccctcagaacagacgaggaactttcttggtgagggagagcgagactactaaaggggcg
tattgcctgtcagtgctggattatgataacaccaaaggcgctaatgttaaacattacaaa
atcaggaaactggatagcggaggtttctacatcacttcacgcacccagttcaccagccta
cagcagctagtcttccactatcgcaagcactctgatggactgtgccacgctctaacagat
gtttgtccagtgaccaaacctcagacgcagggactggctagggatgcctgggagatcccc
agagagtctctccgccttgacgtcaaactgggacagggctgctttggagaagtctggatg
ggtacgtggaacggtacaacacgagtagccattaagactctaaagcccggcaccatgtct
ccagaggccttccttcaagaagcacaggtcatgaagaagctgcggcacgaaaagctggtc
cagctgtacgccgttgtgtctgaggagcccatttatattgtaacagagtatatgagccaa
ggcagcttactggactttcttaaaggcgaagctggaaagctgcttcgtctgcctcagctg
gtagacatggctgctcagattgcagcaggcatggcctacgtggagaggatgaactatgtc
cacagggacctgcgtgctgcaaacatcctggtaggagacagcctcgtgtgcaaggtggct
gactttggtctggcaagactcattgaagacaatgagtacactgcaagacagggagccaag
ttcccaatcaaatggacagcaccggaggcagctctgtatggtcgtttcaccattaagtca
gatgtctggtcctttggtgtgctgctcacagagctggcaactaaaggcagagttccctat
ccaggtatggttaaccgagaagtgcttgaccaagtggagcgtggctacaggatgccttgt
ccagcagagtgcccaagctccttgcatgagctcatgctttcctgctggaggaaggatcca
gaagagaggcctacatttgagtacctgcagggcttcctagaggactacttcacctccaca
gaaccccagtatcagcctggggagaacctatag

KEGG   Maylandia zebra (zebra mbuna): 101479745
Entry
101479745         CDS       T02814                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04137  Mitophagy - animal
mze04144  Endocytosis
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04520  Adherens junction
mze04530  Tight junction
mze04540  Gap junction
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04912  GnRH signaling pathway
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101479745
   04370 VEGF signaling pathway
    101479745
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101479745
   04137 Mitophagy - animal
    101479745
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101479745
   04520 Adherens junction
    101479745
   04530 Tight junction
    101479745
   04540 Gap junction
    101479745
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101479745
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101479745
  09152 Endocrine system
   04912 GnRH signaling pathway
    101479745
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101479745
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101479745
Protein kinases [BR:mze01001]
 Non-receptor tyrosine kinases
  SRC family
   101479745
Membrane trafficking [BR:mze04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101479745
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    101479745
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101479745
  Macropinocytosis
   Kinases
    101479745
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 zf-RING_14
Other DBs
NCBI-GeneID: 101479745
NCBI-ProteinID: XP_004560362
LinkDB
Position
LG20
AA seq 552 aa
MGGSKSKSKDVGQRTRSLDGNLSSGGGAGGHHLNSTQQSLTPNRSPTVDAGLSGNQSMAN
TAELTLFGGVDNNSVTSSNCIARAGGVTTFVALYDYESRTATDLSFRKGERLQIVNNTRK
VNCREGDWWLARSLTTGESGYIPSNYVAPSDSIQAEDHLKLALESRWYFGKITRRDSERL
LLSLENRRGTFLVRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFN
SLQQLVNHYRKHADGLCHSLTDICPVLKPQTQGLAKDAWEIPRESLRLDIKLGQGCFGEV
WMGTWNGTTQVAIKTLKPSTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYM
GQGSLLDFLKGDMGKMLRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCK
VADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRV
PYPGMVNREVLDQVERGYRMPCPAECPESLHELMLSCWRKEPEERPTFEYLQGFLEDYFT
STEPQYQPGENL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggggggatccaagagcaagtccaaggatgtaggccaacgaacacgcagcctcgatggc
aacctcagctcgggtggaggggctggcggccaccatctcaactccactcaacagtcctta
acaccaaaccgcagccctactgtggatgcaggtctcagtgggaatcagtcaatggctaat
actgcagagctaacgctctttggaggagtggacaataacagtgtcacctcttcaaactgc
atagcacgagcaggaggggtgacgacctttgtggcattatacgattatgaatctcgaaca
gccacagatctgtcttttaggaagggcgaacggctccagatagtaaacaatacgaggaag
gtgaactgcagagaaggggactggtggctggcgcgctccctgaccaccggagagagcggt
tatatccccagcaattatgtggctccatctgactccatccaagcagaagatcatctcaaa
ctggctctagagtccaggtggtactttggcaaaatcacacgccgcgattctgagaggctg
ctgctgagtttagagaacaggagagggactttcctggtgcgagagagtgaaaccaccaag
ggtgcctactgtttgtctgtattggattatgacaacacaaaagggttaaatgtgaagcac
tacaagatcaggaagctggacagtggaggcttctacatcacgtcacgcacccagttcaac
tccctacagcagcttgtcaatcattaccgcaagcatgctgatggattgtgtcacagccta
acagacatatgtcctgtactgaagcctcagactcagggcttagcaaaggacgcctgggag
atcccgagagagtctctccgtcttgacataaagcttggacagggctgcttcggcgaagtc
tggatgggaacatggaacggtacaacgcaggtggcgattaagaccctgaagcccagcacc
atgtccccagaggccttcctgcaggaggctcaggtcatgaagaaactgagacatgaaaag
ctggttcagctttacgctgtggtgtctgaggagccgatttacatcgtcacagagtacatg
ggccaaggtagcctactggactttctgaaaggggacatgggtaagatgcttcgccttccc
cagctggtggacatggcctcacagattgcttcagggatggcttatgtcgagaggatgaac
tatgtgcaccgtgatctaagagctgctaacatcctggtgggagataacctggtttgcaaa
gtggctgactttggtttggctcgcctcatagaggataacgaatatactgccaggcaaggt
gccaagtttcccatcaagtggacggcccctgaggctgcgctgtatggccgctttaccatt
aaatcagatgtatggtcatttgggatcctactgactgaactggctactaaaggccgagtc
ccatacccaggtatggtgaaccgggaggtgttagaccaggtggagcgtggttataggatg
ccgtgtccagcagagtgccccgaatcccttcatgagctgatgctgagctgctggaggaag
gaacctgaggagaggccaactttcgagtacctgcagggcttcctggaggattactttacc
tccacagagcctcagtaccagccaggagagaacctgtaa

DBGET integrated database retrieval system