KEGG   Maylandia zebra (zebra mbuna): 101476882
Entry
101476882         CDS       T02814                                 

Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04137  Mitophagy - animal
mze04140  Autophagy - animal
mze04141  Protein processing in endoplasmic reticulum
mze04210  Apoptosis
mze04217  Necroptosis
mze04310  Wnt signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04622  RIG-I-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101476882
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101476882
   04012 ErbB signaling pathway
    101476882
   04310 Wnt signaling pathway
    101476882
   04068 FoxO signaling pathway
    101476882
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101476882
   04137 Mitophagy - animal
    101476882
  09143 Cell growth and death
   04210 Apoptosis
    101476882
   04217 Necroptosis
    101476882
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101476882
   04530 Tight junction
    101476882
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101476882
   04621 NOD-like receptor signaling pathway
    101476882
   04622 RIG-I-like receptor signaling pathway
    101476882
   04625 C-type lectin receptor signaling pathway
    101476882
  09152 Endocrine system
   04910 Insulin signaling pathway
    101476882
   04920 Adipocytokine signaling pathway
    101476882
   04912 GnRH signaling pathway
    101476882
   04914 Progesterone-mediated oocyte maturation
    101476882
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101476882
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101476882
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101476882
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101476882
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 101476882
NCBI-ProteinID: XP_024660524
LinkDB
Position
LG2
AA seq 420 aa
MSEAEGQFYSVQVVDSTFTVLRRYQQLRPIGSGAQGIVCSALDTVLSIPVAVKKLCRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLINVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSLEFMNRLMETVRNYVMNKPQYPGVSFAELFPDWAFPSESEHDKLKTSQARDLLSKML
VIDPECRISVEEALNHPYIHVWYDPAEADAPPPQISDKQLEEREHTIEQWKELIYEEVID
WEERNKNGLMKEDCSDVVSCSASQSSSANDISSMSTEQTLASDTDSSSIDTLTGPLDENH
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgagtgaggcggaggggcagttctacagtgttcaggtggtggactccaccttcactgta
ctcagacgctaccagcagctgcggcccattggctctggcgcccaaggcattgtttgctct
gctctagatacggtcctcagtataccagtggcagtgaaaaagctgtgtcggccctttcag
aaccagacccacgctaagcgcgcctacagggagctggtgctgctcaaatgtgtcaaccac
aaaaatatcatccgtctgatcaatgtattcacgcctcagaagtccctggaggaatttcag
gatctgtatctggtgatggagctaatggatgccagcctatgccaggtgatccatatggac
ctagaccacgagaggatgtcctacctgctataccagatcctttgtggaatcaggcacctg
cactctgctggcataatccacagggatctgaagcccagtaacattgtggttaagtcagat
tgcacactaaagatcttggactttggcttagctaggacagcctgcactaatttcatgatg
accccgtacgtggtgaccagatattaccgtgccccggaggtcattctcggtatgaagtac
aaggaaaatgtggacatctggtcagtggggtgtatcatgggagagatggtaaagggcagc
gtcatcttccagggcactgatcacatcgaccagtggaataaggtgattgagattctgggc
acacccagtctagagtttatgaaccgactgatggagactgtgaggaactatgtgatgaac
aagccacagtatcctggtgtcagctttgccgagcttttcccagactgggccttcccttct
gagtcagaacatgacaaattgaagacaagtcaagcacgggacttgctttccaaaatgcta
gtcattgatcccgagtgccgcatatctgtagaagaagctcttaatcacccctacattcac
gtgtggtacgacccggcagaggccgacgcgcctcctccacagatttctgacaagcagttg
gaagagagagagcacactattgagcagtggaaagaacttatttatgaagaggtgattgac
tgggaggagaggaacaagaatggtctaatgaaagaagattgctcagatgtggtgtcatgt
tcggcctcccagtcctcttcagccaacgatatctcgtccatgtccacagagcaaaccctg
gcctcagacacagacagcagcagcatcgacacactgacaggacctctggacgagaatcac
tga

KEGG   Maylandia zebra (zebra mbuna): 101477577
Entry
101477577         CDS       T02814                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04137  Mitophagy - animal
mze04140  Autophagy - animal
mze04141  Protein processing in endoplasmic reticulum
mze04210  Apoptosis
mze04217  Necroptosis
mze04310  Wnt signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04622  RIG-I-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101477577
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101477577
   04012 ErbB signaling pathway
    101477577
   04310 Wnt signaling pathway
    101477577
   04068 FoxO signaling pathway
    101477577
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101477577
   04137 Mitophagy - animal
    101477577
  09143 Cell growth and death
   04210 Apoptosis
    101477577
   04217 Necroptosis
    101477577
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101477577
   04530 Tight junction
    101477577
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101477577
   04621 NOD-like receptor signaling pathway
    101477577
   04622 RIG-I-like receptor signaling pathway
    101477577
   04625 C-type lectin receptor signaling pathway
    101477577
  09152 Endocrine system
   04910 Insulin signaling pathway
    101477577
   04920 Adipocytokine signaling pathway
    101477577
   04912 GnRH signaling pathway
    101477577
   04914 Progesterone-mediated oocyte maturation
    101477577
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101477577
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101477577
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101477577
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101477577
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 101477577
NCBI-ProteinID: XP_004555925
LinkDB
Position
LG13
AA seq 465 aa
MIITLRALFEQGRTFLDAQKAVIKDFTMNKNKREKEFYSVDVGDSTFTVLKRYQNLRPIG
SGAQGIVCSAYDQILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFT
PQKSFEEFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLK
PSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGC
ILAEMVRHKILFPGRDYIDQWNKVIEQLGTPSQDFLMKLNHSVRTYVENRPRYAGYSFEK
LFPDVLFPADSDHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPAEVEAP
PPKIPDKQLDEREHTVEEWKELIYKEVSEWEEWKRNGVIRGQPSPLGAAVIDSPPQPTSS
SSSSANDISSMSTEPTDPSSDPTMTSETDSSLDGHTSLGALACCR
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgatcataacactgcgggctctcttcgaacaggggaggacatttttggatgcacagaag
gcagtaatcaaagatttcaccatgaataaaaacaagagagaaaaggagttctacagcgtc
gatgtgggggactcaacattcaccgtgctgaagcgataccagaatttaagacccattgga
tcaggagcacagggtatcgtctgctctgcttacgaccaaatccttgaaagaaatgttgcc
atcaagaagctgagccggccgtttcaaaatcagacccacgccaagagggcgtacagagag
ctagtcctaatgaaatgtgtcaatcacaaaaatatcattggtctgttaaatgtatttaca
ccacaaaaatcattcgaagaattccaagatgtatacttggtgatggagctgatggatgcc
aacctgtgccaggtcatacagatggagctagaccacgagaggctctcctatctgctctat
cagatgttgtgcggaataaaacacctccatgctgccggcatcattcacagggacctcaag
cccagtaatattgtcgtcaagtcagactgcacactaaagattttagacttcggcttggct
cggacagctgcgacgggcctcctgatgacaccgtatgtagttacacggtactacagagca
cctgaggttatcctgggcatgggctaccaagccaatgtggacatatggtcagtgggctgc
atactagcggaaatggttcggcataaaatccttttcccaggaagggactacatcgaccag
tggaacaaggtaattgagcagctaggcactccatctcaggactttctaatgaagctgaac
cattcagtaagaacgtacgtagaaaacaggccccgctatgctggatacagctttgagaaa
ctcttcccagatgttctcttccctgccgactctgatcacaacaaactgaaagcaagccaa
gctagagatctcttatccaagatgttagtaattgacgcctccaagcgtatttcggtagac
gaggccctgcagcacccctatattaacgtttggtatgatccagctgaagtggaagcgccc
ccaccaaagatcccggacaaacaactggatgaacgggagcacaccgtggaagagtggaaa
gagctgatttataaggaagtgagtgaatgggaggaatggaaaaggaacggagttataaga
ggccagccgtctcctttaggtgcagcagtgattgacagccctcctcagcccacatcttcc
tcttcctcttcggccaacgacatctcgtccatgtccacagagcccactgacccaagcagt
gaccccaccatgacctcggaaacagacagcagcttagacggtcacacctctttgggcgcg
ctggcctgctgcagataa

KEGG   Maylandia zebra (zebra mbuna): 101480702
Entry
101480702         CDS       T02814                                 

Gene name
mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04137  Mitophagy - animal
mze04140  Autophagy - animal
mze04141  Protein processing in endoplasmic reticulum
mze04210  Apoptosis
mze04217  Necroptosis
mze04310  Wnt signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04622  RIG-I-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101480702 (mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101480702 (mapk8)
   04012 ErbB signaling pathway
    101480702 (mapk8)
   04310 Wnt signaling pathway
    101480702 (mapk8)
   04068 FoxO signaling pathway
    101480702 (mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101480702 (mapk8)
   04137 Mitophagy - animal
    101480702 (mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    101480702 (mapk8)
   04217 Necroptosis
    101480702 (mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101480702 (mapk8)
   04530 Tight junction
    101480702 (mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101480702 (mapk8)
   04621 NOD-like receptor signaling pathway
    101480702 (mapk8)
   04622 RIG-I-like receptor signaling pathway
    101480702 (mapk8)
   04625 C-type lectin receptor signaling pathway
    101480702 (mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101480702 (mapk8)
   04920 Adipocytokine signaling pathway
    101480702 (mapk8)
   04912 GnRH signaling pathway
    101480702 (mapk8)
   04914 Progesterone-mediated oocyte maturation
    101480702 (mapk8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101480702 (mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101480702 (mapk8)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101480702 (mapk8)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101480702 (mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 101480702
NCBI-ProteinID: XP_014265218
LinkDB
Position
LG8
AA seq 442 aa
MNRNKREREYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPTEVEAPPPVITDKQLDEREHTVEEWKELIYKEV
LDWEERTKNGVIRGQPASIGAAVSSSPQQHHQHHPSTSSSTSANDVSSMSTDPTLTDTDS
SLETAGPAAAAATASGPMGCCR
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaaccgaaacaagcgtgaaagggagtactacagtatagatgtgggcgattcaactttt
acagttttaaagcgctaccagaacctaagacccattggatccggcgcacagggaattgtt
tgttcggcgtacgaccacaacttggagaggaacgttgccatcaagaagttgagccgaccc
tttcagaatcaaactcatgcaaaacgggcctacagggaactggtgctaatgaaatgtgtc
aaccacaagaatattattgggctgttaaatgtattcacaccacagaagacactggaggaa
ttccaagatgtgtatctagtaatggaactgatggatgccaacctctgtcaggtgattcag
atggagctggaccacgagaggctgtcgtacctgctctaccagatgttatgtggaatcaaa
catctgcacgccgcagggatcatacacagggacctgaaacccagcaacatcgtggtaaag
tccgactgcacactgaagattctggactttggtttggcccggacggccgccactggtctc
ctcatgacgccctacgtggtgacgcgttactaccgcgcccctgaagtcatcctgggaatg
ggctaccaggccaacgttgatgtctggtctgttggctgtatcatggctgaaatggtccgg
ggtagtgtgttgtttccaggcactgatcatattgaccagtggaacaaggtgatcgagcag
ctggggacgccatctcaggagttcctgatgaagctcaaccagtccgtgaggacctatgtg
gagaaccggccacggtatgctggctacagcttcgagaagctcttccctgatgtcctgttt
cctgcagactctgagcacaataaactgaaagcgagccaagcccgtgacctcctatcaaag
atgctggtaatagatgcatcaaagcggatctcagtggatgaggctctccagcacccctat
atcaacgtgtggtacgacccaactgaggtggaggcaccaccaccggtgatcacagacaag
cagctggatgagcgggagcacacagtggaggaatggaaagagttgatatataaagaagtg
ctagactgggaagaaaggacgaagaacggcgtcatcaggggacagccggcgtccataggt
gcagcagtgagcagcagcccccagcagcaccaccagcaccatccctccacttcttcctcc
acctccgccaacgatgtctcctcaatgtccaccgacccgaccctgaccgacaccgacagc
agcctggagacggcgggccctgccgccgccgctgctacagcctccggcccaatgggctgc
tgcagatga

KEGG   Maylandia zebra (zebra mbuna): 101486303
Entry
101486303         CDS       T02814                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04137  Mitophagy - animal
mze04140  Autophagy - animal
mze04141  Protein processing in endoplasmic reticulum
mze04210  Apoptosis
mze04217  Necroptosis
mze04310  Wnt signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04622  RIG-I-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101486303 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101486303 (mapk10)
   04012 ErbB signaling pathway
    101486303 (mapk10)
   04310 Wnt signaling pathway
    101486303 (mapk10)
   04068 FoxO signaling pathway
    101486303 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101486303 (mapk10)
   04137 Mitophagy - animal
    101486303 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    101486303 (mapk10)
   04217 Necroptosis
    101486303 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101486303 (mapk10)
   04530 Tight junction
    101486303 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101486303 (mapk10)
   04621 NOD-like receptor signaling pathway
    101486303 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    101486303 (mapk10)
   04625 C-type lectin receptor signaling pathway
    101486303 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101486303 (mapk10)
   04920 Adipocytokine signaling pathway
    101486303 (mapk10)
   04912 GnRH signaling pathway
    101486303 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    101486303 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101486303 (mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101486303 (mapk10)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101486303 (mapk10)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101486303 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101486303
NCBI-ProteinID: XP_004549739
LinkDB
Position
LG7
AA seq 476 aa
MVFMSRHFLYNCSQPVLDVKIAFCQGFGKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRMSVDEALQHP
YINVWYDPAEVEAARDNIQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNG
VVKGQPSPSGAAVNSSESLPPSSSINDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggtatttatgagcagacatttcttatataactgcagccaaccagtcctggatgtaaag
atagccttttgtcagggttttggaaaacaagtggatgtgtcatatattgccaagcattac
aacatgagcaaaagcaaagtggacaaccagttctacagtgtggaagtgggagactctacc
ttcacagttttaaaacgctaccagaatttaaagcccattggttctggagctcagggaatt
gtctgtgcgggctatgacgctgtcctggacagaaatgtagccatcaagaagctgagcaga
cccttccagaaccagacccatgccaagagggcataccgggagttggtgctcatgaaatgc
gtcaatcacaaaaatattatcagtttattaaatgtcttcacaccacagaaatcattagag
gaattccaggatgtgtatctagtgatggaactaatggatgccaacttgtgccaggtgatt
cagatggagcttgaccatgagagaatgtcctacctgctctaccagatgctgtgtggtatc
aaacatctgcactcagccggcattattcacagggatctcaaaccaagcaatatagtggtg
aaatcagactgtaccctgaaaatcctggatttcggtctggctaggactgcaggcaccagt
ttcatgatgaccccgtatgtggtgacccgatactacagagccccagaggtcatactagga
atgggatacaaggagaatgtggatatttggtcggtggggtgcattatgggagaaatggtg
cgccacaaaatccttttccctggccgggactatattgatcagtggaacaaagtgatcgag
cagctgggcacgccctcgccagaattcatgaagaaacttcaacccacagtgaggaactat
gtcgagaaccggccaaagtacgcaggcctcaccttccccaaactcttccccgactgcctt
ttccctgctgactctgagcacaacaaactcaaagcaagccaggctagagacctgctgtct
aagatgctgattatcgaccctgctaagcggatgtcagtggatgaggccttacagcacccc
tacatcaacgtgtggtatgatccggctgaggtggaggcggccagagataacatccaaata
tccatgcctccacctcagatctacgacaagcagctggatgaaagagaacactccattgat
gaatggaaagaacttatctacaaagaggtgatgaactttgaggagagaacgaagaatggc
gttgtgaagggacaaccttcaccttcaggtgcagccgtgaacagcagcgagagcctccct
ccctcctcctcaatcaacgacatctcctccatgtccaccgaccagaccctggcctcagac
actgacagcagcctggagacctctgcaggacccttggggtgttgcaggtga

DBGET integrated database retrieval system