KEGG   Maylandia zebra (zebra mbuna): 101477281
Entry
101477281         CDS       T02814                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04068  FoxO signaling pathway
mze04144  Endocytosis
mze04510  Focal adhesion
mze04520  Adherens junction
mze04540  Gap junction
mze04810  Regulation of actin cytoskeleton
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101477281
   04012 ErbB signaling pathway
    101477281
   04068 FoxO signaling pathway
    101477281
   04020 Calcium signaling pathway
    101477281
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101477281
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101477281
   04520 Adherens junction
    101477281
   04540 Gap junction
    101477281
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101477281
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101477281
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101477281
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101477281
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101477281
Protein kinases [BR:mze01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101477281
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101477281
  Exosomal proteins of pancreatic cancer cells
   101477281
  Exosomal proteins of bladder cancer cells
   101477281
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH
Other DBs
NCBI-GeneID: 101477281
NCBI-ProteinID: XP_014269303
UniProt: A0A3P9CZM6
LinkDB
Position
LG9
AA seq 1175 aa
MKLLCGGGAALLLLLLGRCCCTTPDRRVCQGMSNHLSLLGTYEQHYDSMVRMYSNCSVVL
ENLEITYTQEHHDLSFLQSIQEVGGYVLIAMNDVATIPLVNLRLIRGQNLYEGRFALLVM
SNYHKNASSATINYTSGLKQLQLSSLTEILKGGVKVTRNPLLCNIETIDWWDIVDKASNY
SVVFTKDDFPKKCQTCDPSCHNSSCWAAGQDHCQRFTKLLCAEQCSWRCRGPKPVDCCNE
HCAAGCTGPRATDCLACRAFNDDGICKDACPPLKRYDSILHQVVENPNAKFTFGATCVKA
CPHNYVVTEGSCVRSCSNRMYEVKENGIQRCKDCDGPCPKACDGVRFGTLINTIAINASN
IDLFKDCTKINGDVVILESSFTGDPHYNIPPMEPEKLENFKTVKEITGYLVIQFWPKNLT
SLSVFENLEIIRGRTTFSKHSLAVVSLKHLRWLGLRSLKEVSAGVVAVKNNPELCYVWKD
QWAHLFRSTDQTINLLNNSPPDVCERNNQTCDTECTDLGCWGPGPTMCLSCRQFNRKGRC
VVSCNLLQGEPREVEVNGSCVQCHPECLLQTGSLTCSGPGPDKCSQCAHVKDGPHCVPHC
PHGVQGEGGKLVWKYADRMGQCQSCHQNCSEGCSGPGLSGCNGSLAHSTLAASVIGGLLL
LVIVSLIIFVLLRRMQIKRKRTVRRLLQERELVEPLTPSGQAPNQALLRILKETEFKKVR
VLGSGAFGTVYKGLWIPEGENVKIPVAIKVLREATSPKANQEVLDEAYVMASVDHPHVCR
LLGICLTSSVQLVTQLMPYGCLLDYVRHHRDSIGAQWLLNWCVQIAKGMNYLEERHLVHR
DLAARNVLLKSPNHVKITDFGLAKLLTADEKEYHADGGKVPIKWMALESILQWTYTHQSD
VWSYGVTVWEIMTFGSKPYDGIPASEIATVLGRGERLPQPPICTIDVYMIMVKCWMIDPS
SRPRFKELMVEFSKMASDPSRYLVIQGDLPSPSDSRFYSRLLSTDDTEDVIDPDEYLLPY
RGMGNHKDRPMNGHPAGENSLALRYITDPTDSALEKDFIDHEYMNQSVSETSQSSRLSKV
LNPNYEDLSLGWGPLPHPLEDLNTSQVPYGPEYLNASFKLRPLVTSHSLDNPDYQADFLP
QTIKDATLAENHLFLPAAENLEYLGVGGALHAPVR
NT seq 3528 nt   +upstreamnt  +downstreamnt
atgaagcttctctgcggaggaggagcggcgctgctgctgctgctgctcggccgctgctgc
tgcaccactcccgacaggagagtgtgtcagggaatgagcaaccacctgtcgctgttgggg
acgtacgagcagcactacgacagcatggtgaggatgtactccaactgctccgtggtgctg
gagaacctggagatcacctacacgcaggagcaccacgacctgtccttcctgcagtccatc
caggaagtaggcggttatgttctgatcgctatgaacgatgtggcgaccatcccattggtc
aacctgagactgatccggggacagaacctgtacgaaggccggttcgctctgctggtgatg
tctaactatcacaagaacgcctcatctgcaaccatcaactacaccagcggcctgaaacag
ctgcagctcagcagcctgaccgagatcctgaaaggaggtgtaaaggtgacccgcaatcct
ttgctgtgcaacatagagaccatcgattggtgggacatcgtggacaaggccagcaattac
agcgtggtgttcaccaaggacgactttccaaagaaatgtcagacgtgtgaccccagctgt
cataacagctcgtgctgggcagcaggacaggatcactgtcagagattcaccaagctgctg
tgtgcagagcagtgcagctggaggtgtcgggggcccaaacccgtcgactgctgtaacgag
cactgtgctgcgggctgcactggacctcgggccaccgactgcctggcctgcagggctttc
aacgatgacggaatctgtaaagacgcgtgtccacctttgaaacgctatgactccatactt
catcaggtggtcgaaaaccccaacgccaaattcacctttggagcgacctgcgtcaaagcc
tgcccacataactacgtggtgactgaaggctcgtgtgttcgttcctgtagcaacaggatg
tacgaggtgaaggagaatggaatccaacgctgcaaagactgtgacggaccctgtcctaaa
gcatgtgacggggtcaggtttggcactctgatcaacaccatcgctatcaacgcctccaac
attgacttgtttaaggactgcaccaaaatcaacggcgacgtcgtcatccttgaatcctcc
ttcactggggatccacattacaacatcccacccatggagcccgagaagctggagaacttc
aagacagtgaaggaaatcactggttacctggtgattcagttctggcccaagaatctgaca
tctctgtctgtgtttgagaacctggagatcatcagaggaagaacgacattctcgaaacac
agtttggccgtggtgagcttgaagcacctgcggtggctgggtttgcgctctctgaaggag
gtcagtgccggagtagtggcagtgaagaataaccccgagttatgttatgtttggaaagac
cagtgggcccacctattcagatcaaccgaccagaccattaacttgttgaacaacagtccc
cctgatgtgtgtgagaggaacaatcaaacctgtgacacggagtgtacagatttaggctgc
tggggtccagggcccaccatgtgtttgtcctgccggcaattcaaccgcaagggccgctgt
gtggtgtcgtgcaacctgctgcaaggggaacccagagaggtggaggtaaatggcagctgt
gtccagtgtcacccagagtgtctgctgcaaaccgggtcgctgacctgctccggaccgggc
cctgacaagtgttcccagtgtgcccatgttaaagatggcccccactgcgtgccacactgc
cctcatggtgtgcagggagagggaggcaagttggtctggaaatacgccgacagaatgggc
cagtgccagtcctgccaccagaactgcagcgaggggtgttctggtcctggattgtctgga
tgcaatggctctcttgcacactctacactggcggccagtgtgattggagggctcctgctt
ctcgtcattgtgtcgctgatcatctttgtgttgctacgacgaatgcaaattaagaggaag
cgaactgtacgccgcctgctgcaggagagagagctggtggagccgctgacccccagtggt
caggcacctaaccaggcactgctgaggatcctgaaggagaccgagtttaagaaggtcagg
gtgctcggctccggcgcctttgggacggtgtacaagggtttgtggatccctgaaggcgag
aatgtgaagatcccagtagccatcaaagttctcagagaggccacgtcaccgaaagccaac
caagaagtcctggatgaagcgtatgtgatggcgagtgtggatcaccctcatgtgtgccgc
ctgctgggaatctgcctgacatcatcagtccagctggttactcagctgatgccgtacggc
tgcttgctggactatgtccggcaccacagggatagcattggggcgcagtggctgctcaac
tggtgtgtccagattgctaaggggatgaactacctggaggagcgtcacctggtgcatcgt
gacctggctgcaaggaacgtccttttgaagagtcctaaccacgtcaagatcaccgacttc
ggccttgccaagcttctgacggcagatgagaaggaatatcacgctgatggaggaaaggtt
cccattaagtggatggcattagagtcgatcctccagtggacttacacccatcagagtgat
gtctggagttatggtgtgacggtgtgggagatcatgacgttcggctccaagccatacgac
ggcatcccggccagcgagatcgccacggtgctggggagaggcgagcggctgcctcagccc
cccatctgcaccatcgatgtctacatgatcatggtcaaatgctggatgatcgacccgtcc
agtcggcccaggttcaaagagctgatggtggagttctccaagatggccagcgacccgtcc
agatacctggtcatacagggggacctgccaagtccgtcagacagcaggttttactctcgt
ctgctgagcaccgacgacaccgaggacgttattgacccggacgaatacctgctgccctac
agaggcatgggtaaccataaggaccggcccatgaatggtcatccggccggagagaacagc
ctcgccctgcggtacatcaccgatcccactgacagcgcactggaaaaggacttcatcgac
cacgagtacatgaaccagagtgtgagtgagaccagccagagcagccggctctccaaggtt
ttaaaccctaattatgaggacctgagcctgggctggggcccacttccccacccgctggag
gatctgaacacctcccaagtgccctatggacctgaatacctgaacgcgtccttcaaactg
cgccctctggtgaccagtcacagccttgataatccagactaccaggctgacttcctgcct
cagaccattaaagatgcaacgttagcggagaaccatctgttcctcccagcagcagagaac
ctcgagtatctgggtgtgggcggcgctctacatgctcctgtccgctag

KEGG   Maylandia zebra (zebra mbuna): 101483528
Entry
101483528         CDS       T02814                                 

Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04068  FoxO signaling pathway
mze04144  Endocytosis
mze04510  Focal adhesion
mze04520  Adherens junction
mze04540  Gap junction
mze04810  Regulation of actin cytoskeleton
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101483528
   04012 ErbB signaling pathway
    101483528
   04068 FoxO signaling pathway
    101483528
   04020 Calcium signaling pathway
    101483528
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101483528
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101483528
   04520 Adherens junction
    101483528
   04540 Gap junction
    101483528
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101483528
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101483528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101483528
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101483528
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101483528
Protein kinases [BR:mze01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101483528
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101483528
  Exosomal proteins of pancreatic cancer cells
   101483528
  Exosomal proteins of bladder cancer cells
   101483528
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kdo LapA_dom Kinase-like APH
Other DBs
NCBI-GeneID: 101483528
NCBI-ProteinID: XP_004542932
UniProt: A0A3P9DEP6
LinkDB
Position
LG18
AA seq 1206 aa
MTPSHRELQNNTMAARFLKWISLTSLLWLSFCGLAQNKVCQGVTNRLNLLGTKEDHYRNM
VKTYSNCTVVLENLEITHMEDHRDLSFLRSIKEVGGYVLIALNTVSRIPLENLRIIRGHS
LYDGSFALSVISNYNKSTNKGTDQILLTSLTEILKGGVKFLTNQLCNVETIQWSDIVNVG
NISIDPTPSKNKNCGKCDSGCFNGSCWAPGPENCQTLTKLNCAQQCSKRCKGPSPSDCCN
EHCAAGCTGPRAEDCLACRDFQDDGVCKDSCPGLHRYDPNLHQLVPNPHGKYSFGATCVK
SCPRNYIISDYGACVRTCNDNTYEVEVGGIRKCAKCDGLCPKVCNGLGTGDLVHTLSINA
TNIGSFENCTKINGNIDIIHTSINGDQYTKTPKMDPAQLNVFKTVKEITGYLWIQTWPNT
MSSLSPFENLEVVRGRTKRGSRSLVVAGLHITHLGLRSLREISDGDVFVSKNSELCYTDA
KHWQKLFKSPHQTVNIEGNANAATCALRNDTCDKKCTADGCWGPGPSMCILCRDYKRDGS
CVDSCNILEGEPRETAVNKTCIKCHPECQHMNGTATCSAPESANCTKCANFKDGLFCVPR
CPQGVLGEDDALVWKYADEQKVCQQCHKNCTQGCIGPGLEGCHSKGPLGLSMVAAGVVGG
LLAALIAGLSVFVLLRRRHIKRKRTMRRLLQERELVEPLTPSGEAPNQALLRILKEPEFK
KIKVLGSGAFGTVYKGLWVPEGEDVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPH
VCRLLGICLTSTVQLITQLMPYGCLLDYVKEHKDNIGSQYLLNWCVQIAKGMNYLEERHL
VHRDLAARNVLVKTPQHVKITDFGLAKLLKADEKEYHADGGKVPIKWMALESILNRTYTH
QSDVWSYGVTVWELMTFGTKPYDGIPASEIAGILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPRFRELIAEFTKMARDPPRYLVIQGDDRMHLPSPSDNKFYRSLISGEDMEDAVDV
DEYLVPQRGFFSSPSTSRTPLIHSTSLNSSIGTCHSRTGLLNGFPSRDGSMALRYIPDPT
DKFLDEAFQPSPGYMNQNPISDVVNPIYQHPGPPRTLLPTISSDHTETEYLNYFKNGAAG
PEYLNEILSPAVLPLTSNGTVHSIEKYLPQQSIDNPDYQQDFTPTFKTHTNGHIPAAENA
EYLGPD
NT seq 3621 nt   +upstreamnt  +downstreamnt
atgacaccttctcaccgggagcttcaaaataacacgatggcagcccgttttctcaagtgg
atcagtctcacgtctctgctttggctgagcttctgcggtctggcgcaaaataaagtgtgc
caaggtgtaaccaatcgtttaaaccttttgggaactaaagaggaccactacaggaacatg
gtgaagacctacagcaactgcaccgtagtcttggagaacctggagatcacacacatggag
gatcaccgtgacctgtccttcctccggtcaatcaaagaagttggtggctacgtcctgatc
gccctcaatacagtatccaggattcctctggagaacctgcgcatcattcgaggccattct
ctctatgatggaagttttgctctttctgtgatttctaattataacaaatctacaaataag
ggcaccgatcagattcttctgaccagcctgacagaaattcttaaaggaggagtaaaattt
ttgaccaaccagctttgcaatgtggaaacaatccagtggtctgatattgttaatgttgga
aacatcagcattgatccaactcctagcaaaaacaaaaattgtggaaaatgtgactcaggc
tgtttcaatggctcatgttgggcacctggtcctgaaaactgtcagactttgacaaagctg
aactgtgcccagcagtgctccaagaggtgcaaaggaccttcaccgagtgactgttgcaat
gagcattgtgccgcggggtgcacgggacccagagctgaagactgtctggcctgtcgggac
ttccaggatgatggggtgtgtaaggactcctgcccaggccttcatcgttacgaccccaac
ctgcaccagctggttcctaatccgcatggaaagtacagcttcggggccacctgtgtcaaa
agctgcccacgtaattatattatttctgattacggcgcatgtgtgcggacgtgcaacgat
aacacatatgaggtggaggtaggaggaatcaggaagtgcgccaagtgtgacgggctgtgt
ccaaaagtgtgtaatggacttggaacaggagacttggttcacactctgtctatcaatgcc
acaaacatcggctcctttgaaaactgcaccaaaatcaatggaaacatcgacatcatccac
acatcaattaatggggatcaatacaccaaaacaccaaagatggatcctgcccagcttaat
gtgtttaagacagttaaagaaattactgggtacctgtggattcaaacgtggccaaatacc
atgagctcactgagtccttttgagaatctggaggtcgttcgggggagaactaaacgcgga
agccgcagtttggttgtggctggtctacatatcacccacctgggcctgaggtccctcaga
gaaatcagtgatggagatgtgtttgtctctaagaactctgaactctgttacaccgatgca
aagcactggcagaagcttttcaaatcaccacaccaaactgttaatatagagggcaatgcc
aacgctgccacctgcgctctgagaaacgacacttgcgacaagaagtgcacggcggacggc
tgctggggtccgggccccagtatgtgcattttgtgccgcgactacaagcgcgacgggagc
tgcgtcgactcctgcaacatcctggagggagagccgcgcgagacagctgtgaataaaacc
tgcatcaagtgccaccccgagtgtcagcacatgaacgggaccgcaacctgcagcgcgcct
gagtctgctaactgcactaaatgtgctaacttcaaagatggactgttctgcgtgccccgc
tgtccccaaggcgtgctgggggaggacgacgcactagtgtggaaatacgcagatgaacag
aaagtgtgccagcaatgccacaaaaactgcactcaggggtgcattggaccaggtcttgaa
ggctgccacagcaaaggcccccttggtctttccatggtcgcggctggtgttgtcggtggg
ctgctggccgctctcatcgcaggcctgtctgtttttgtgttgctccgccgacgccacatc
aagaggaagaggaccatgcgtagactgctccaagagagagagttggtcgaacccctcact
cccagtggagaggcaccgaaccaggctctgctgcggatcctgaaggaacccgagtttaag
aaaatcaaggtgctgggatcaggagcttttggtactgtttacaagggtctgtgggtcccg
gagggagaggacgtgaaaatcccggtcgccatcaaggttttgagagaggccacgtcccct
aaagcaaacaaggagatcttggatgaagcttatgtgatggccagtgtggagcacccccac
gtgtgtcgtctgttgggcatctgcctcacctccacggtgcagctcataacgcagctcatg
ccttacggctgcctgttggattatgtcaaagagcacaaggacaatattggctcccagtac
ctgctcaactggtgtgtgcagatagccaagggaatgaactacctggaggagcgccactta
gtgcatcgtgacttggcagccagaaacgtcctggtgaagactcctcaacatgtcaagatc
actgactttggtttggccaagttgctaaaggcagatgagaaagagtaccatgcggatgga
ggaaaggtgccgataaaatggatggctctcgagtcgatcctgaacagaacttacacgcac
cagagcgacgtatggagttacggtgtaacagtttgggagctgatgacatttgggaccaaa
ccatacgatgggattccagccagtgaaatagctgggatactggagaagggagaacgcctg
cctcagccaccaatctgcaccatagatgtctacatgatcatggtgaaatgttggatgatt
gatgcagacagccgccctcgtttccgagaacttatagcggagtttacaaagatggctcgg
gatccaccgcgttatcttgtcatccagggggatgaccgcatgcacttaccgagtccttca
gacaataagttctaccgcagcctgattagcggggaggacatggaggatgccgtggatgtt
gatgaatatctggtgccacagcgtggcttcttcagcagcccgagtacctcccgcacccca
ctgattcactcaacaagcctcaacagcagcatcgggacgtgccacagcagaactggctta
ctgaacggattcccgagcagagatggaagcatggccctgcgatatattccagaccccaca
gacaaatttctcgatgaagccttccagccgtctccaggctacatgaaccagaatcccatc
tcagatgtggtgaatcctatctatcagcatcccggtccacctcgcacccttcttcccacc
atctcctcggaccatacggagacagaatacctgaactactttaagaacggggccgccgga
ccagaatatctcaatgagattctgtccccggccgtcctcccactcacgtcaaacggcacg
gtccacagcattgagaaatacctgcctcagcaaagcatagacaaccccgactaccaacag
gatttcactcccaccttcaagacccacaccaatggacacataccggcagcggagaatgca
gagtacctgggcccggactga

DBGET integrated database retrieval system