KEGG   Maylandia zebra (zebra mbuna): 101477328Help
Entry
101477328         CDS       T02814                                 

Gene name
sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00040  Pentose and glucuronate interconversions
mze00051  Fructose and mannose metabolism
mze01100  Metabolic pathways
Module
mze_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101477328 (sord)
   00051 Fructose and mannose metabolism
    101477328 (sord)
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     101477328 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 PALP Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 101477328
NCBI-ProteinID: XP_004543275
UniProt: A0A3P9AUN1
LinkDB All DBs
Position
LG1
AA seq 354 aa AA seqDB search
MAQDNLSLVLHAKEDLRLENRPIPEPGPNEVLLQMHSVGICGSDVHYWQNGRIGDFVLKK
PMVLGHEASGRVAKVGSEVKHLKVGDRVAIEPGVPREMDEFFKTGRYNLSPTIFFCATPP
DDGNLCRYYTHSANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGSTVFVCGAGPI
GLVCLLAAKAMGASQVVISDLSEERLLMAKDLGADFLLTVRRGDGAQQLAKSVEEMLGAQ
PHITIECTGVESCIQTAIYATRSGGVVVLVGLGSELATVPLINAAVREVDIRGVFRYCNT
WPMAIAMLASGKVNVKPLVTHRFPLEQAVQAFETTRQGLGIKVMLKCDKNDQNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagacaatctgtccctggtgctgcacgctaaagaagacctgcggctggaaaat
cgccctattccggaaccaggacctaatgaggttttgctgcagatgcactctgtgggaatc
tgtggttcggatgtgcactattggcagaatggccggataggggacttcgtgctcaaaaaa
cccatggtgctggggcacgaggcctcggggagagtggcgaaggttggctcagaggtcaag
caccttaaagtgggtgacagagtggctattgagcctggtgtgccccgtgagatggacgag
ttcttcaaaactggacgctataatttatctcccactatcttcttctgtgccacaccccct
gacgatggaaacctctgtcgctattacacgcacagtgccaacttctgttacaagttgcct
gataatgtcacatttgaggagggagcgctcattgagcctttgtctgtgggaatccatgcc
tgccgaagagctggagtgacccttggtagcactgtgttcgtctgtggtgcaggacctatc
gggttggtctgtctgcttgcagccaaggcaatgggggcctcgcaggtcgtcatatctgat
ctgtctgaggagcgtctgctgatggccaaagacctgggtgcagacttcctgctgactgtg
aggagaggagatggagcccagcagctggcaaagagtgtggaggaaatgttgggggcgcag
cctcacattaccattgaatgcactggtgttgagagctgcatccaaactgccatctatgca
acccgttcaggaggtgtcgtggtgctggtgggtcttggctcagagctggctacagttcct
ctgatcaatgccgctgtaagagaagtagacatcagaggagttttccgctactgcaatacc
tggccaatggcgattgccatgttggcgtcaggtaaagtgaatgtcaagccccttgtgacc
catcgtttccctctggagcaggcagtccaagcctttgagaccacacgtcagggtcttgga
ataaaggttatgttgaagtgtgacaaaaatgaccaaaacccctga

DBGET integrated database retrieval system