KEGG   Maylandia zebra (zebra mbuna): 101477849Help
Entry
101477849         CDS       T02814                                 

Definition
(RefSeq) uncharacterized protein LOC101477849
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101477849
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101477849
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     101477849
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101477849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3819
Motif
Other DBs
NCBI-GeneID: 101477849
NCBI-ProteinID: XP_004552532
UniProt: A0A3P9DAF8
LinkDB All DBs
Position
LG4
AA seq 2040 aa AA seqDB search
MDGSTRMSVKELCETDDLATRLVLDPLLGFSTHKMNISPPPEIRRWGNLKETLLRFQRTH
DFNATFEALTVGELAGDYFNALGSHRQELLRQHVYRYLSAFLLDSGVKIESCDRYSSETN
GAKITSTRHWFVGERVEVLLGCIAELSPADSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFVPGEKNIACVEVIRPIAPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFKHRGKQPEIEETKDPVGQKYRLRERYLRHHRERGHFSTRPITPGIHSGIFKAIPSRN
SFTQQMRRNALKNRKLSQTKKWRQEKQRRSGKHPLKSSSTAKQRRTVPLLSQVTLKDLRV
RVRCHSLDFLLNCKDPKSKERALLLQLEEVRPQDNRPRGLNMTGEESNSSAVNLKPFTLN
SSMSACQKSRSAVRGAGLNGRFAKVVGRKPVHMRTSSRTKSSVRTTLTHQTKSSNTTNTT
TVCHPDEGDKICSAIKQENVETAITESQNRGAIETSVITTAQNPAAEQTERKTIRALSTS
NTDGLKNTGDNPLISLKQYLTVNLTRLSVSQSLELGESCEDRKVRVEVRGRRMQSQRPGP
ATEKRASRFQQRQARSSEVCTADGNRGVREMSFKSPDQTSVRKRHSSESTGDLSHSEKKR
SEKFSEIQTASVDDKDFITNEQTDFLKGKTEGQRDSKSNRNLEEVKRSDCKMVSSKCQNN
VQDVKNTAKGVCTQEGSGQMSLSTQPVSRHEDDIVIKQAKVLLSDVLRKDKSLIDGRLKG
GNVGRRFSTWASKESAEEESEQTEINGGRFRRSVQRRIIRRRKIRPRAVKRKAADKPSTK
GHLSKDITATVKTELSQESVEPKLPQRHNDPPATCLNPLPHKSLISAKTTTNPDTNAQVH
AQSNIPLKKRTFRSSALDSEQSLNSALDQVSKNVTELKSSAVLRQDLAPSSGESSKVKRE
NKVRVRRTEMQRLAPRRHSSFNRVLRSRPAEAQRGHLMRNARKCKLERLDEDDAGKAQTL
ESERVEDVAESPTSDEFQSRNQGKLMTLEQSGLEDIKPDFFKIRLKRRRGKVWEMQSAGL
ENMALKAEKGDELVAFDPFKAIMDSVSILNMEMEAAQAHVQASKKSKSRLHRLKKRGEKL
QAINFYTGAKSDKDLENDRENVCGPDVSASNEVQFKEKIDRDPVVGVKQLLEKTESQKND
STALSAAALETKIEEGFLKSSCLFESGSQKKQEPELDINGCPLPVIKLRRKMEDIWEVDS
KEELIQPDLKVETIIKTEMKGHVLGKQKGLSDCCKLKEECPSSERLNNSSLKTEPPPFSL
SLSPLSLSSPLNDSKTEVISVAADRITERPEMISGGRKQRHKMDRTHKCGPVETPTTCLS
HTLQQIDNSLSRLSEGLCSSQTLEKPTASSNSVIQPPSQSPPFATADNMLTSEPSFTNCC
DDILDFQCLNFEGYYQPQNMLPSSPSDLCSLDPPTDPFSSPLSHSPTDTWTTETPYLGPP
SPGNNFTSEDLQFFPGLMPSKSDSVPLECEAKDTSKDRNPPNTSFSYSALGNPDLAAKDR
IISKNPGMRFSKEDLKNQSFMAPSKPRFMGASSSSVTTQSPVTLPHPAMNIKPSTSQSKT
QANLKTQGPFHRMTIPNKSQSFSSNQPNAVRAVSQSCLTKPVQSSQMSNKFLSPQLFTVK
NPNPPDNPFNFPEKTSTVIHRVLKFQGGNQSQNLYSAPCKETTAAGSPTVSSRMLGAKSG
AMEKTQQSPKFCFSADSHQKGNLSVQGFEKDVHLASSNRSNIHFNKPNSSISHSYSKAKM
SSDKHESAEANMAYKNFSILPRQFYFPSKMSDSYSAPHEKSMKQDKSTTPTSDKHQPCYT
QQDPFDFSFGTSLSPMSQHNSPQVVHNTPPATPAPANKSSAPSASFPYGYQGPPYVLNFS
GDHSLTLGLRDGAEGYPGLGSTNYTYHCLMEPSGTQGRLVVEPCGPQLSNPASLAGFSGL
KGRDEHCRKDMQQQCHAGDHQGTSHYGPVTTSHSMGATKPKRVRLVVTDGTVDLDLQYSD
NT seq 6123 nt NT seq  +upstreamnt  +downstreamnt
atggacggaagcactagaatgagtgtgaaggagctgtgtgagacggatgacctggccacc
cgcttggtgctggaccctctgctgggcttcagcacccacaaaatgaacatcagcccccca
ccagagatccgacgttggggtaacctcaaagagacgcttttgaggtttcagcgtacgcac
gacttcaacgctacgtttgaggctctaacggtgggcgagctggctggtgactactttaat
gctttggggagccatcgacaggagctgctgagacaacatgtttatcgctacctcagtgcc
ttcctgttggatagcggtgtcaagatagagtcctgtgacagatactcctcagagaccaac
ggagccaagataacctcaactaggcactggtttgtaggagagcgggtggaggtcctgctg
ggctgcatagcagagctgagtcctgctgacagtgccgtgctgagggcgggagtcaatgac
ttcagcgtgatgtattccacacgcaaacgctgcgctcagctctggctcgggcctgcagct
ttcattaaccacgactgcaagccaaactgcaagttcgtccccggtgagaagaatatcgct
tgtgttgaggtgattcgacccatagcacctggggaagagatcacgtgttactatggagcc
agcttttttggtgaaggcaatgaaatgtgtgaatgctgcacctgtgagaggaatggagag
ggtcacttcaagcacagagggaaacagcctgaaatcgaggaaacaaaggaccccgtgggc
caaaagtaccgcctgagagagcgatatcttcgtcatcacagagagagaggtcacttttct
acaaggccaataacaccaggaatacactcgggaatctttaaagccatcccctcaaggaac
tcattcactcagcagatgagaagaaatgccttgaagaacagaaaactgagtcagacaaag
aagtggagacaggagaagcaaagacgatcaggaaagcacccactaaagtcctcctctaca
gccaaacagcggcgaacggttccgcttttatcccaggttacactaaaggaccttagagtc
agagtgcggtgccactctttggattttttactcaattgtaaggatccaaaaagcaaagaa
agggcattgctgctgcaactcgaggaagtgaggccacaagataacaggccaaggggactg
aacatgactggggaagaaagcaacagcagtgcggtgaacttgaagccctttactctgaat
tcctccatgtcagcatgtcagaaaagcagatctgcggtaagaggcgcaggccttaatggg
aggtttgcaaaagtggtgggcaggaagcccgttcacatgaggacctcttcaagaacaaaa
agcagtgttcgcaccacactcacacaccagacgaagtccagtaacacaactaacactaca
actgtttgtcacccggatgagggcgacaaaatctgcagtgcaataaaacaagagaatgtc
gaaactgcaatcacagaaagtcaaaaccgcggcgccatcgaaaccagcgtcatcaccacg
gctcaaaatcctgctgccgagcaaactgagcgcaagactatcagagctttatccacgagt
aacacggatggattgaagaacactggagacaatccgctaatatctctgaagcagtatctt
acagtcaatctaacgaggttatcggtgtcacaaagtttggaacttggagaaagctgtgaa
gacaggaaagtaagggtggaggttagaggaaggaggatgcagagccagcgcccaggccca
gcaacagaaaaacgagcatccagatttcagcagaggcaggcgagaagttcagaggtctgc
acagctgacggtaacagaggggtgagggaaatgtctttcaagtctccagatcaaaccagt
gtaaggaaacggcattcgagcgagagcacgggcgacttatcccacagcgagaaaaagaga
agcgagaaatttagtgaaatacaaacggcttcggtagatgacaaagattttataacaaac
gaacagacggattttttaaaaggcaaaacagaagggcagagagacagtaaaagtaacaga
aacctagaagaagtgaaaaggtctgattgcaaaatggtttccagcaaatgtcaaaataat
gtccaggatgttaaaaatacagccaagggggtttgcacgcaggaaggatcaggacaaatg
agtttgagtacgcagccagtaagtaggcatgaagatgatattgttataaaacaggcaaag
gttctgctatctgatgttttaagaaaagataaatcattaatagatgggagattaaaggga
ggtaatgtgggacgacggttttctacctgggcctccaaggagagtgccgaggaggaatca
gaacaaactgaaataaatggaggcaggttccggcgttcagtgcagaggaggattattaga
agacgaaagataaggcccagagcagtgaaaagaaaagcagcagataagccaagcaccaag
ggacacttaagcaaagacattacagctacagttaagacggagttgagtcaggagagtgtg
gagcctaagttgccacagaggcacaatgacccaccggccacctgcctcaacccactacct
cacaagtcactgatttcggctaaaaccacgactaatccagacaccaatgcacaagtgcac
gcgcagtccaatatacctctgaagaaacgtacatttcgcagttcggcactagattctgaa
caaagtctaaactctgccttagatcaggtttctaaaaatgttacagagttgaaatcgtct
gcagtgctgaggcaggacctcgccccgtcttcaggggagagtagcaaagtgaaaagagag
aataaagtcagagttaggaggacagaaatgcagcggttagcccccagaagacactcctct
tttaacagggtccttcgctcgagacctgctgaagctcagcgtggtcatttaatgaggaac
gctcgaaagtgtaaattagagaggctggatgaggatgacgccggtaaagcacagacacta
gagagcgagcgtgttgaggatgtagccgaaagtccgacttcagatgaatttcaaagtaga
aatcaggggaaattgatgaccctggaacaaagtggtttggaagacataaagccagacttt
tttaaaattcggcttaagaggagaagagggaaagtatgggagatgcaaagtgcagggttg
gaaaacatggcattaaaagcagaaaagggagatgagttggtggcattcgatccttttaaa
gctattatggactcggtgtcaattttaaacatggagatggaggcagctcaggctcacgtg
caagctagtaagaagtcaaagagcagattgcatcgtttgaaaaaaagaggagagaagttg
caagctataaatttctacactggtgcaaaatcagacaaggaccttgaaaatgacagggaa
aacgtctgtgggcccgatgtgtctgccagcaacgaagtacaattcaaagagaaaatcgat
agggaccccgtggttggagtcaagcagctgctagaaaaaacagagagtcagaaaaatgac
agcacagccctgtcagcggcagcgctggaaacaaaaatcgaagaaggttttttaaagagt
tcctgcttgtttgaaagtgggtcacaaaaaaagcaagagccggaactggacataaatggc
tgtccattaccggtaattaaactgcgtaggaagatggaggatatttgggaggtggatagt
aaagaggagctcatacagcccgatttaaaagtagagaccattattaagacagagatgaag
ggtcacgttttaggtaaacaaaaaggactttccgattgttgcaagctcaaagaagagtgc
ccatcttctgagagactgaacaacagctctctgaaaaccgaaccgccaccattttctttg
tccctatcaccgctgtcgctgtcctcgcccctcaacgacagtaaaaccgaagttatatcc
gtagctgcagacagaatcactgaaaggccagagatgatcagcggaggaaggaaacagagg
cacaaaatggacagaacacacaagtgtgggcctgtcgaaacacccaccacttgccttagt
cacactcttcagcaaattgataacagtctctctcggctttccgagggcttgtgttcatct
cagactttggaaaagcccacagcctcttctaattctgtcatccaacccccatcccagtct
cctccatttgcaacagcagataacatgcttaccagcgagcccagcttcacaaactgctgt
gatgacattcttgactttcagtgtctcaactttgagggctattaccagccacagaacatg
cttccatcttccccatcagatctgtgttccctggatcctcctacagatcctttcagcagt
cccctctctcacagccctaccgacacgtggaccacggaaacgccataccttggccctccc
agtcctggaaataactttaccagtgaggatttgcagttttttccaggcctaatgccttcc
aaaagtgactcagttcctctggaatgtgaagcaaaggatacctccaaagacagaaaccca
cccaacaccagtttcagttattcagctctgggcaaccccgacttggcggctaaagatcga
attataagtaaaaatccgggaatgaggttttccaaagaagacttaaaaaatcagtctttc
atggcacccagtaagcctcgttttatgggtgcgtcatcgtcttcggttacaactcaaagc
cctgttactttaccccaccctgccatgaacataaagccaagcaccagccaatcaaaaacc
caggctaacctcaaaacccagggtcccttccatcgtatgaccattcccaataaatcccag
tcgttttctagcaatcagccaaacgcagttagagcagtgtcccagagctgcttaacaaag
cccgtacagtcgtctcaaatgtctaacaaattcctctctcctcagctcttcactgtgaaa
aatcccaaccctcccgacaatccattcaactttcctgagaaaacctctacagttattcac
agggtgctcaagtttcaggggggcaaccagagtcagaacttgtacagcgcaccttgcaaa
gagaccacggctgccggcagcccgaccgtctcgtccagaatgctaggtgcaaaatcaggt
gctatggagaaaacccagcagagtccaaagttctgctttagtgcagacagtcatcagaaa
ggcaacttgtctgttcaggggttcgaaaaggacgttcacctcgcttcctccaacaggtcc
aacattcatttcaataaacccaactcctcaatttctcattcttatagtaaagctaagatg
tcatcagacaaacatgaaagtgccgaagccaacatggcatacaaaaacttttctatcttg
ccgaggcagttctactttcctagcaaaatgtccgacagttattcagcaccgcacgagaaa
agcatgaaacaggataaatccactacgccgacctcagacaaacaccagccgtgttacact
cagcaagacccctttgatttcagttttggcacttctctttcgcccatgtctcagcacaac
agcccccaagtggttcacaatacaccacctgctacaccagcaccagcaaacaagtcctca
gccccctcagcctcgttcccttacggctatcaaggtcctccttacgtactaaacttcagt
ggagaccattctttgaccctgggtctcagggatggtgctgaaggctacccaggactgggc
tcaacaaactacacctaccactgcctgatggagccttcgggcacacaggggcggctggtc
gtcgagccctgtggaccccagctctccaacccagcttctctggctggattttcagggctc
aaaggtcgcgacgagcactgcaggaaggatatgcagcagcagtgccacgctggggatcac
caaggcacatcacactatggacctgttacaacatctcactccatgggtgccacaaaaccc
aagagggtgaggttagtggtgacagacggcacagtggacttagatcttcagtactcggac
tga

DBGET integrated database retrieval system