KEGG   Maylandia zebra (zebra mbuna): 101478446
Entry
101478446         CDS       T02814                                 

Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04060  Cytokine-cytokine receptor interaction
mze04068  FoxO signaling pathway
mze04144  Endocytosis
mze04218  Cellular senescence
mze04350  TGF-beta signaling pathway
mze04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101478446
   04350 TGF-beta signaling pathway
    101478446
   04068 FoxO signaling pathway
    101478446
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101478446
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101478446
  09143 Cell growth and death
   04218 Cellular senescence
    101478446
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101478446
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101478446
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101478446
Protein kinases [BR:mze01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101478446
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Choline_kinase
Other DBs
NCBI-GeneID: 101478446
NCBI-ProteinID: XP_004566372
UniProt: A0A3P9CXN7
LinkDB
Position
LG16
AA seq 613 aa
MRGSPLTPGAEDRSTNTPTDRGPLSFIDLLCRKMMAQCWTIWTGILVLLTACLPVDVQSL
SHLSFNLCRWCEVSTPVCEGNICSSNCNLSSFCNTTEEICMAIWRKANNTMTVYTMCHHP
NLPLDGISPDLLQTFTSRECRMVPQAANDSMMVCGCQGEHECNDKLVFDKGANGFLPLQS
KDVIPVVVVSLVPPILVAIVAIAAFYFYRIRRPDKPAPSVCPDWPTKRTPELYQALDLPC
GGLGAQGEGGGGGVTDAEQDESNTKVQPLNSDTISGMTSWQGQPAELLPIKLDVLVGKGR
FAEVWRGWLLQGEKGGVNSYETVAVKVFPDVEYASWRNECSIFADPKLQHDNVIQFLAAE
ERGLSGHTPHTYWLVLAYHSLGNLQDFLTANILSWEELVAMAGSIAKGLAHLHSDTTLSG
LPKVPVAHRDLKSSNILVKSRKECALCDFGLALRLDLSLTVDDYANSGQVGTARYMAPEV
LESRVNLEDLEAFKQMDVYSMALVLWEMASRCNAIGEVKSYEPAFGSKVCEQPCVDSMRD
LVLRDRGRPDIPLAWTQHQGMNIFCSTITECWDHDPEARLTAHCVVERFSALEQAEDDDR
VGDEEDEEEVSQE
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgagaggctctccgctgacaccgggggctgaagaccgaagcaccaacacaccgactgac
cggggtcccctgagtttcatcgacttactttgccggaagatgatggctcagtgctggacg
atttggaccgggatcctcgtcctcctgactgcctgtcttccagttgatgtccagtcttta
agccacctgagcttcaatttatgcaggtggtgtgaggtatccacgccggtgtgcgaaggc
aacatatgctccagcaactgcaacttgagctctttctgcaacaccactgaagagatctgc
atggccatatggaggaaggcaaacaacacaatgacagtgtacacaatgtgtcaccaccca
aatctgccactggatggtatcagtcctgacctgctgcagaccttcacttccagggagtgt
cgtatggtcccacaggctgcaaatgactccatgatggtctgtggatgtcagggtgaacat
gaatgtaacgacaaacttgtcttcgacaagggagcaaatggattcttaccgctccaaagt
aaggatgtgatccctgtggtagtggttagtttggtgccccctattctggtggccatagtt
gccattgctgccttctatttctaccgcatacgtcgtcctgacaaaccagctccgtcagta
tgccctgactggcccactaaacgcacccctgagctttaccaggccttggatctaccatgt
gggggcctgggtgctcagggagaaggtggaggaggaggtgtgactgatgctgaacaggat
gagtcgaacaccaaggttcaacctcttaacagtgacactatcagcggtatgaccagttgg
cagggccagccagctgaactgctacctatcaaactggatgtgctggtggggaaggggcgc
tttgccgaagtgtggaggggatggctgctccagggcgagaaaggtggagttaatagctat
gaaactgtggcggtgaaggtgtttccggatgtggagtacgcctcatggagaaatgaatgc
tccatctttgctgaccccaagctacagcacgataatgtgattcagttcctagcagctgag
gaaaggggcctgtcgggccacaccccacacacctactggctggttttagcctatcacagc
ctaggaaatctgcaggacttcctcacagctaacatattgagctgggaagaacttgttgcc
atggcaggcagcattgctaaaggattagctcaccttcatagtgacacaacactcagtggg
ctaccaaaggtaccagtggcccatcgggacctcaagagcagtaacatcctggtaaagagc
aggaaagagtgcgcactgtgtgactttggtctggctttaagactggacctgtcccttaca
gttgatgactatgccaacagtggacaggtggggacagctcgctacatggctcctgaggtc
cttgagtccagggtgaacctggaggatctcgaggcctttaaacagatggatgtttattcc
atggctctagtgttgtgggagatggcctctcgatgcaatgcaattggagaggtaaagagc
tatgagccagcatttggctccaaggtttgtgagcagccctgtgtggatagcatgagagat
ctggtgttgagagaccgaggacgtccggacatcccactagcatggacgcagcaccagggg
atgaacatcttctgttccaccatcactgagtgctgggatcacgaccccgaggctaggctc
acggctcactgcgtggtcgagcgcttcagcgccctggagcaggcggaagatgacgacagg
gtgggagacgaagaagacgaggaagaagtaagtcaggagtaa

DBGET integrated database retrieval system