KEGG   Maylandia zebra (zebra mbuna): 101478461Help
Entry
101478461         CDS       T02814                                 

Gene name
galnt17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00512  Mucin type O-glycan biosynthesis
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101478461 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mze01003]
    101478461 (galnt17)
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101478461 (galnt17)
Glycosyltransferases [BR:mze01003]
 O-Glycan biosynthesis
  Mucin-type
   101478461 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin
Motif
Other DBs
NCBI-GeneID: 101478461
NCBI-ProteinID: XP_004569642
LinkDB All DBs
Position
LG14
AA seq 600 aa AA seqDB search
MAFVFRRWRVLLVLNVLAVAGFITFWAKCNNARSIQTTGPEAAGDGKRARGNGTAQGPSV
SHEVLLKRLSSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLPATLSPAEESDAKYLREKY
GYNAYLSDRISLDRTIPDHRPSKCRKVSYSRDLPQISLIFIFVNEALSVILRSVHSAVNH
TPAHLLKEVILVDDNSDDEQLKGPLEEYVNKRYPGLVKIVRNQKREGLIRARIEGWKVAT
AEVTGFFDAHVEFTPSWAEPVLARIKENHKRIILPSIDNIKHDTFEVERYENSGHGYNWE
LWCMYINPPKEWWEEGDMSAPIRTPAMIGCSFVANRDYFGELGLLDSGMDVYGGENIELG
IRVWLCGGSMEVLPCSRVAHIARMKKPYHSNIAFHTRRNALRVAEVWMDEYKSNVYLAWN
IPMENHGIDYGDISQRVALRKSLQCKSFHWYLDNVYPEMRRYNDTLFYGEVRNSKASHLC
MDQGVKENHTATLHPCHGWGPQLGRYTKEGQLFLGPLGSTGEDTRCVVDDQISNFPQLLN
CEKVTNVKQKTWHFSQNELIINRATGRCLEVVPANVYFGHLLVLQPCSGQRWTIKNTMKQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtgttcagaagatggagggtcttactggtgctgaacgtgctcgcggttgcc
gggttcattactttctgggccaagtgcaacaacgcacgcagcatccagaccaccggtcca
gaggccgcgggtgatgggaagagagcccggggcaacgggacggcacaggggcccagcgtc
agccatgaggtgctgctgaaaaggctcagctctctggaggacgtggtgtacaggcagcta
aacggtctgtccaaatctctgggcctgattgagggctttgggggtcggggtaaaggcggc
ctccccgccacgctgtcaccggctgaggagagtgacgctaaataccttagggagaagtac
ggctataatgcctacctcagtgacagaatttctctggatcgcacaataccagaccatcgg
cctagcaaatgtagaaaggtcagctactcaagagaccttccccaaatctccctcatcttc
atcttcgtcaacgaggctctgtcggtgatcctgcgctcagtccactcagctgtcaatcac
acaccggcgcacttgctcaaggaggtcatcctggtggacgacaacagcgatgacgagcaa
ctgaaaggtccactggaggagtatgtgaacaaacgctatcccggcctggtgaagattgta
aggaaccaaaagagagagggattgatcagggccaggatcgagggttggaaggtagccact
gctgaggtgacaggattttttgatgcccatgtggagttcaccccatcatgggcagaacca
gttctagctagaataaaagaaaaccacaagaggattatcttgccgtcaatcgacaacatc
aagcacgataccttcgaggtggagcgctatgagaactctggccatggctacaactgggaa
ctgtggtgcatgtacattaatccacccaaagagtggtgggaggagggagacatgtctgca
ccaataaggacgcctgccatgattggatgctcctttgtggccaatcgggactactttgga
gaactcggtctactcgactcaggcatggacgtctacggaggggagaacatcgaactaggc
atcagggtgtggctgtgtggaggcagtatggaggtgctgccttgctccagagtggctcat
attgcacgaatgaagaaaccttaccacagtaacatagctttccacacacgccgtaatgcc
ctgcgtgtggcagaggtctggatggatgagtacaagtccaatgtctacctggcctggaac
atccccatggagaaccacggtattgattacggagacatatcacagagggttgcactgagg
aagagtctgcaatgtaagagctttcactggtacctagacaacgtttacccagagatgagg
aggtacaacgatacgctgttctacggtgaggtccgcaattctaaagcaagccacctgtgt
atggatcagggtgtgaaggagaaccacacagccaccctgcacccatgccatgggtggggt
cctcagttaggacgctacactaaagaaggtcagctgtttctgggacccctaggcagcact
ggtgaggacactcgttgtgtggtggacgatcagatcagcaactttcctcagctcctcaac
tgtgaaaaggtgaccaacgtgaaacagaagacatggcatttctctcagaacgaattgatc
ataaatcgggctactggacgctgtctggaggtggtgccggctaatgtttacttcggccac
ctgctggtcctgcagccctgctcggggcagaggtggaccatcaagaacactatgaagcag
tga

DBGET integrated database retrieval system