KEGG   Maylandia zebra (zebra mbuna): 101478640Help
Entry
101478640         CDS       T02814                                 

Gene name
hdac6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mze01009]
    101478640 (hdac6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mze03019]
    101478640 (hdac6)
   04131 Membrane trafficking [BR:mze04131]
    101478640 (hdac6)
   03036 Chromosome and associated proteins [BR:mze03036]
    101478640 (hdac6)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101478640 (hdac6)
Protein phosphatases and associated proteins [BR:mze01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101478640 (hdac6)
Messenger RNA biogenesis [BR:mze03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101478640 (hdac6)
Membrane trafficking [BR:mze04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    101478640 (hdac6)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101478640 (hdac6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var
Motif
Other DBs
NCBI-GeneID: 101478640
NCBI-ProteinID: XP_004568222
LinkDB All DBs
Position
LG20
AA seq 1104 aa AA seqDB search
MQSGSDPPGHGPKPVRRSPRLSPQVGSSEGTQENKGGNSLQELKRRGRMERTREEREEEL
SGKLKTLDLSSRSAASGTGLVYSEIFTHHKNEWDPSHPESPDRVTAIMKELERQDLLPLC
IRVEPREATEEELLLAHMKHYVDLIKSTQTMTLAELQTLSNKYDSIYLHPESFQVSVTAV
GAVLQLVDRVMTSELKNGFAIIRPPGHHAQANECNGYSIFNNVAIAARYAQTRHAISRVL
IVDWDVHHGQGIQYRFQEDPSVLYFSVHRYEQGSFWPHLPESDSHFVGSGPAEGRNINLP
WNQTGMTDADYIAAFQQVLLPVAYEFQPQLVLVSAGFDAAVGDLKGEMCVSPQCFQVLTH
MLMSLAEGRLVLALEGGYNYESSAESAAACIRALLGGPCPPLTTPTAPSDSALQSISQTI
SALYPHWASLQVLEGSPSAEGRAISTSSNQKNTMKPNLAPSVATTTGLVYDERMMEHSNL
WDRHHPEQPQRIFKIFSKHQQLGLVDRCQRIPVRLATEEELSLCHSMQHIEQMKATAMMK
PRELHKLGDEFVSIYLNQQSFQCAQLAAGSCLNALDQILCGQVTNAVAIVRPPGHHAERD
YPCGFCLFNTAALAARYAKKASHDPLMRILILDWDVHHGNGTQHMFEDDGSVLYISLHRY
DNGAFFPSSEDAAPDKVGVAKGAGFNVNVAWSGGRMGDSDYLAAFHRVVMPIATEFNPSL
VLVSAGFDAARGDPLGGYNVTPEGYAHLTHMLMSLAGGRVLVILEGGYNLSTISDSMAMC
TSMLLGDPPPALVTPLPPPHHSAVATINEVIRYHVPYWRSLRIDVPESVRAALPTLKHRG
KRSSKGKGRKSEQGSNDKPPVPPARPDDSTTVSSLEQLTQGLASLDIGQTSANQNPASSP
VGGARPKVPLSSEKPTCEEVKKESDDSTPACSESADSMSCQPVGVATPESVAGVDKVEAG
AGAEPEPEGACGWSKPQTSLELMCGADADGSTLYVVDPLSWCPHLDAVKPLPSSGIDVFR
PCQDCGSEAENWICLTCYQVFCGRYVNEHMVNHGVVSEHPLVLSFCDLSAWCYLCEAYVH
NQILFEAKNAAHCGKFGEEIPPWS
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcggggtcagatcctccagggcatggaccgaagccagttagaagatctcctcgt
ctgtcccctcaggtcggcagcagtgagggaacacaggagaacaaaggaggaaacagcctg
caggagctgaagaggagaggaaggatggagaggaccagagaggagcgagaagaggagctg
agtggcaaattgaagacactggatctgtccagcagatcagcagccagtggaacgggtctc
gtttactcggagatcttcacccaccataagaacgagtgggacccgagccatccagagagt
ccggacagagtgacagccatcatgaaggagctggagagacaagatctgctgcctctctgt
atcagagttgagcccagagaagctacagaggaagagctgctgctggctcacatgaaacac
tatgtggacctgataaagtcgactcagacgatgacactggctgaactccaaactctgtcc
aacaaatatgattccatttatctccatccagagtccttccaggtgtctgtgacagctgtg
ggtgcagtgcttcagctggtcgatcgggtcatgacctctgaactcaagaacggattcgcc
atcatcagacctccaggtcatcacgctcaggccaacgagtgcaacggttactctatcttc
aacaacgtggcgatcgcagctcgatacgctcagaccaggcacgccatcagcagggtgctg
atagtggactgggatgtacatcacgggcagggcatccagtaccggttccaggaggatccc
agtgttctgtacttcagcgtccacaggtatgagcagggctctttctggcctcacctgcca
gaatccgacagccattttgttggcagcggaccagctgaaggaagaaacatcaacctgccc
tggaaccagacggggatgaccgacgctgattacatcgcggcttttcaacaagtgctgctg
cccgtcgcctacgagtttcagcctcagctggttctggtctctgctggattcgatgccgca
gttggagatctgaagggtgagatgtgtgtgagtcctcagtgtttccaggttctgactcac
atgttgatgagtttggcagaaggtcgacttgttctcgctctcgagggaggttataattat
gagtcatcagctgagagtgctgcagcctgcattcgagctctgctgggtggaccatgtcct
cctctaactacacccactgctccgtctgacagtgctctgcagtccatctctcagaccatc
tcagctctgtatccacactgggcctctctgcaagtgctggaaggcagcccgtcggctgag
ggacgtgccatcagcacatcgagcaatcagaaaaatacaatgaagcccaaccttgccccc
tctgttgccacgacaacaggtctggtttatgatgagaggatgatggagcattcgaacctg
tgggacagacatcacccggagcagcctcagcgaatctttaagatcttctccaaacatcag
caactgggattggttgatcgctgccagcggataccagttcgcttggcgacagaggaggag
ctgtccttgtgtcacagcatgcagcacatcgagcagatgaaagccacggcgatgatgaag
cccagagagctgcacaaactgggcgacgagttcgtctccatttacctcaaccagcagagc
ttccagtgtgcacagctggcggctggaagctgcctcaacgccttggaccagatcctgtgt
gggcaggtgactaacgccgtggccattgtccgtcctcctggtcatcacgctgagagagac
tatccctgtggcttctgtttattcaacacggcagctctcgctgctcgctatgccaagaaa
gcctctcatgatcccttgatgcgaatcctcatcttagactgggatgttcaccacggcaac
ggcacgcagcacatgttcgaggacgatggcagtgtcctctacatctccctccaccgctac
gacaacggtgcattctttccatcttcagaggacgctgcccccgacaaggtgggcgtggcc
aagggggcgggttttaatgtcaatgtggcatggagcggaggaaggatgggtgactcggac
tatcttgcagcttttcaccgtgtcgtcatgcctatcgccactgagtttaaccccagtctg
gttctggtgtcggccgggttcgacgcagcccggggggatcccctgggtggctacaatgtg
actccagaaggatacgcccacctcacacacatgctgatgtcactggctggggggcgggtc
ctggtcatactggagggaggttacaatttgtcaaccatctctgactccatggcgatgtgc
accagcatgttgctaggagacccccctcctgccttggtgacgcctctccctcctcctcac
cacagtgccgtggcaacaataaacgaggtcatccgataccacgtcccctactggaggtcc
ctgaggattgacgttccagagtctgtccgggcagccctgcctaccctgaagcatcgtggg
aaacgtagttctaaaggaaaaggcaggaagtcagagcagggcagcaacgacaaaccgccg
gtgccccctgcacgaccggacgactctacgacggtgagcagtctggagcagctcacacag
ggattggccagtttggacatcggtcagacctcagccaatcagaaccctgcatcctctcca
gtgggaggagctaggccaaaggtccccctgagctcagagaagccaacctgtgaagaagtg
aagaaggagtcagatgacagtacacctgcgtgcagcgaatcagcagacagtatgtcgtgt
cagcctgttggcgtggcaacaccagagtcggtcgcaggtgtagataaggttgaagccggg
gccggggcggagccagagcccgagggagcgtgtggttggtcaaagcctcagacatccctg
gaactgatgtgtggcgccgacgcagatggatcaactctgtatgtggtggaccctctctcc
tggtgtcctcacctggatgccgttaagcccctcccctcctcgggtatagacgtcttccgg
ccgtgtcaggactgcggctcagaggctgagaactggatctgtctcacttgctaccaggtg
ttctgtggtcgctatgtgaacgaacacatggtgaatcacggagtcgtgtctgaacatccc
ctggttctcagtttctgcgatctctctgcgtggtgctacctgtgtgaggcctacgtacac
aaccagattctgtttgaagctaaaaacgctgctcactgcggcaagtttggagaggagatc
cccccctggagctga

DBGET integrated database retrieval system