KEGG   Maylandia zebra (zebra mbuna): 101479128
Entry
101479128         CDS       T02814                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
mze  Maylandia zebra (zebra mbuna)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 101479128
NCBI-ProteinID: XP_004548695
UniProt: A0A3P9CBJ6
LinkDB
Position
LG5
AA seq 365 aa
MSWEEFIELRDLRSTKEQIELTGTRAPCSPPRLERTNALRISPGRVPDLLSRVGIIRVLS
SSQDPQLTEEKGEGHDFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCKFTCHYRCRALI
QLDCSWERGSLADPTCVVEYTIETDTNVDEQIELSKQELTVVDIQQKVKEYNAQINSNLF
MNMNKDGSYTGFIKVQFKLARPVSVPTPKKGGNDTGGRRASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPAKFALFERSERHDQVYIRKLSDTERPLRLRLCAGPN
EKVLSFVLKENETGEVNWHAFSMPELKNFLRILQREEEEHIKQIVQRYALARTKMQEALA
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttgggaggagttcatcgagctccgtgacctcaggtcgaccaaagagcagatagag
ctgacggggacgcgcgctccgtgctcacctccgcgcctagagagaaccaacgccctgagg
atcagcccgggaagggtcccagacctactgagtcgtgtgggcattatcagagtcctgagc
agcagccaggacccacagctcacagaggagaaaggagagggccacgacttccaaccctgt
agccacgctcagcccacgtggtgcgacctgtgtggagactttatctggggcctttacaag
cagagcctgcggtgtgtcaattgtaaattcacatgtcactaccgatgccgtgccctgatt
caactggactgcagctgggaacgaggctccttggctgaccccacatgtgtcgtggagtac
accatagaaacggacacaaacgtggatgaacagattgaattgagtaagcaggagctgaca
gtggtggacattcagcagaaagtgaaggagtacaatgctcagatcaacagcaatctgttc
atgaacatgaacaaggatgggtcctacaccggcttcataaaggtgcagttcaagctggcc
cgacccgtgtctgttcccaccccaaagaaaggaggcaacgacacaggcgggaggcgggcc
agcggagtgaagcggcgcacctctttctacctgccgaaggacgcgtccaagcatttgcac
ataagttctcgaacttcggctcgtgaggtcatcgaggctttgttgaagaagttcaccgtt
gtggacaatcccgccaagtttgctctatttgagcgcagcgagcgtcacgaccaagtttat
atccgtaagctgtctgataccgagcgtccccttcgtctgcgtctgtgcgctggaccgaat
gagaaagtcctcagttttgtgctgaaagagaacgaaactggcgaagtcaattggcatgcc
ttctccatgcccgagttaaagaacttcctgcggattctgcagcgtgaagaggaggaacat
atcaagcagatcgtgcagcgctacgcgttggctcgcactaaaatgcaggaggctctggct
ggctcaacgcccggctga

DBGET integrated database retrieval system