KEGG   Maylandia zebra (zebra mbuna): 101479644Help
Entry
101479644         CDS       T02814                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease serine 2 isoform X1
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mze01002]
    101479644 (tmprss2)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101479644 (tmprss2)
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101479644 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101479644
NCBI-ProteinID: XP_004561663
LinkDB All DBs
Position
LG10
AA seq 503 aa AA seqDB search
MRRGERETNECGNRVREPKETFEVSQSSSSSGSKISFTMNNNQVSGPMYDNQVFKHEEYS
PPYSVTQQIPSHSSINQYYTSTPGIPANPRQTKGRKKCHWKYILSAFLCVTVILAVLGLL
LWYFLYYQCLLGKSCGKGGMCLSHTRWCDGTIDCPDGEDESQCFRLQGANSMLESYSSSS
QTWMPVCADNWDDNYGRTVCRQIGYSRDDYFAYSQTSAGSLASNGYMRLESGSNSGSLIQ
SQLTHSLLCFSKAVTLQCIECGKSSAAPSSRIVGGTEAVNGAWPWQVSLQVSGRHSCGGS
VISRYWILSAAHCFKYSSSPSLWRVYYGDVNLENMFNSRVQKIIKHKDFDTRTNNYDIAL
LKLDTPLTFNNKVRPVCLPNVDLNLSANRQAWITGWGALQSTGPTPKIMNQAKVTIYSRA
TCNAPEVLNGEVTKAMFCAGSLEGGVDSCQGDSGGPLVVKEGNRWWLAGATSYGYGCALK
NKPGVYANVPFFIDWIYENIQNN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagacggggagagagagaaacaaacgagtgcggtaacagagtcagagaaccgaaggaa
actttcgaggtttcacagagttcttcttcttcgggcagtaaaatcagtttcactatgaat
aataatcaggtgagcggtcccatgtatgacaaccaagtgtttaaacatgaagaatatagt
cctccatattctgtaacacagcagatccccagccattcctccatcaaccagtattatact
tcaacacccggaataccagctaatccaaggcaaacaaaaggaagaaagaaatgtcactgg
aagtacatcctgagtgcatttctgtgtgtgactgttatcctggcagtgctcggactcttg
ctgtggtacttcctatactaccagtgtctactggggaagtcgtgtggaaaaggtgggatg
tgtctgagccatacccggtggtgtgatggaaccattgactgtccagatggagaggatgaa
tctcagtgctttcgcctccaaggggccaactccatgctggagagttattcatcaagcagc
cagacctggatgcccgtgtgtgctgacaactgggatgataactatggacgaactgtgtgc
agacagattggttacagcagagatgattattttgcctacagccaaaccagtgcaggttct
ttggcctccaatggatatatgaggctggagtctggaagtaatagtggctcactaatacag
tcacagctcactcacagcttactgtgcttctccaaagctgtcacacttcagtgtattgaa
tgtggcaagagttcagcagctccgagcagtcgtattgttggtggcacagaggctgtaaat
ggagcctggccatggcaggtcagcctccaggtttcaggtcgacacagctgcggaggctcc
gttatcagccgatactggatcctgtctgctgcacactgctttaaatattcctcttctcct
tcattgtggagggtatactatggggacgtgaacttggaaaacatgtttaacagcagagtt
cagaaaatcatcaaacataaagattttgacacaagaacgaataattatgacattgctctc
ctaaagcttgatacacctctgacttttaacaataaagttcggccggtgtgtctccccaat
gttgacctgaacctttctgctaatcgtcaagcatggatcacaggatggggagcactgcag
tcaacagggccaacccccaaaataatgaatcaagccaaggtgaccatttacagcagggcc
acttgtaatgcacctgaagtattaaatggtgaagtcaccaaggccatgttctgtgcaggt
agcctggagggaggagttgactcctgtcagggtgacagtggaggtcccctggtcgtgaaa
gaaggaaatcgatggtggctggcaggagctacgagctatggttatggatgtgctttgaag
aacaagccaggagtctatgccaatgtaccattctttattgactggatatacgaaaacata
cagaataactga

DBGET integrated database retrieval system