KEGG   Maylandia zebra (zebra mbuna): 101479983
Entry
101479983         CDS       T02814                                 

Definition
(RefSeq) uncharacterized protein LOC101479983 isoform X1
  KO
K05461  KIT ligand
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101479983
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101479983
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101479983
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101479983
SSDB
Motif
Pfam: SCF EVI2A Shisa
Other DBs
NCBI-GeneID: 101479983
NCBI-ProteinID: XP_004548225
LinkDB
Position
LG17
AA seq 242 aa
MDVKVPFLLLSLLTNLTLCFEYGSPVTDLHRVALLKQDLPSDYLVPISYVPNEVAGTCWV
VLNIYPLEQSLERLTNNFGDKSTNRESLLIFIEILQTVWLKFDHMKVEILMQYFDCHYQE
QHIPSGPYFDYMENLLRGADRGLFDFSCEPPPCPSTRQTFTTPQETSQSPPNLRTQQTPE
FLEDDNLTLLIFVTISIAVCVIVCVFLSLSRSRRRLHVCSTENIQMQPTKMTQTPTASLK
HD
NT seq 729 nt   +upstreamnt  +downstreamnt
atggatgtcaaggtgccttttctcctcctgagtctcttgacaaatttgactctctgcttt
gaatatgggtcaccagtaaccgatctccatagagtggcactgttgaagcaggatcttccc
agtgactatttggttcccattagttatgttcccaacgaggtggctggcacttgttgggtg
gtgctaaatatctatccattggagcaaagtcttgagagattgaccaacaattttggtgac
aaatccaccaacagagaaagcctgcttatttttattgaaattctccaaactgtgtggctg
aagtttgaccatatgaaagtggaaatattgatgcagtactttgattgccactatcaggaa
cagcacataccatctggcccttactttgactacatggaaaacctcttacgtggagctgat
cgaggactatttgatttctcatgtgaaccaccaccgtgcccaagtactcgacaaacattt
acgactcctcaagaaacatcccagtcaccacctaaccttagaactcaacaaacaccagag
tttctggaggacgacaacttgacgcttttgatttttgtcaccatctccattgcagtttgt
gtcattgtttgtgtgtttttgtcgctgtccaggtcccgaaggcgtttacatgtttgcagc
actgaaaatattcaaatgcaacctactaaaatgacccaaactccgactgcctctctgaag
catgattaa

DBGET integrated database retrieval system