KEGG   Maylandia zebra (zebra mbuna): 101480287
Entry
101480287         CDS       T02814                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101480287 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101480287 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mze03310]
    101480287 (nr3c1)
Transcription factors [BR:mze03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101480287 (nr3c1)
Nuclear receptors [BR:mze03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101480287 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 101480287
NCBI-ProteinID: XP_004550398
UniProt: A0A3P9B1R5
LinkDB
Position
LG10
AA seq 802 aa
MDQGGLKRNGNRDDGLTFAEIEGTGDTPGSLFQTAMHLPGSLPPATVAPNRQGGTNGQGE
LGGLFESHQHHVLGEGTDMKEGKMIRMQKQQQQQQQQDIGIFGMGDSLPLFNQCISDTPT
SVINTSDTSVLGNLPLPDLFSHPIKTESILSLDKDLGTYSGHTGTGPCDLDGNSGRLIED
TEIWQDLDLPSSLPEISAFELDSEVAHLDNILQESTGGGCPVGGLPKEIKPLMGNGENCT
SVNGTKQQHHALHPHQQQQQHHQLIHHQQHQPQHHQPQALLSTIIIKEEKDPDESFIQIC
TPGVIKQEKQDNGFCQPQCLQSGISSLHGGGPRPMSSPVSVGAVPGYHYTANLSSTMDIQ
DQKPFDMYSNMPLMGDGWARGKRYGETSGIQSSDDGPSPVASLAPFSVGFSSSSPREGEI
SSSVVPAQSKTSGQTHKICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNTDGQH
NYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLIKMKVHRAGASEPTISN
MPVPVVPRSMPQLVPTMLSILKAIEPEIIYSGYDSTLPDTSSRLMSTLNRLGGQQVVSAV
KWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSYEQCNGSMLCFAPDLVINKDRMK
LPFMTDQCEQMLKICNEFVRLQVSYEEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYIK
ELGKAIVKREENPSQNWQRFYQLTKLLDSMQEMVEGLLQICFYTFVNKTLSVEFPEMLAE
IISNQIPKFKDGNVKALLFHQK
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggatcagggtggactgaagcgcaatggtaatcgagacgacggcctgacatttgcggag
atagaaggtactggtgacacacctggttcactgttccagactgcaatgcatctgcctggg
tctctgccccctgccacagtggcccccaatagacagggtggaaccaatggccagggggag
cttggaggcttgtttgagtctcatcagcatcatgttctgggtgaggggacagacatgaag
gagggtaaaatgattcgaatgcagaaacaacaacaacagcagcagcaacaggatattggt
atattcggcatgggggacagcttgccattgtttaaccagtgtatttccgatacacccaca
tctgtcattaacacctcagacacttccgtcctaggcaaccttcctctgcctgaccttttt
tcccaccccataaagacggaaagcattctttctctggacaaagacttgggaacttatagt
gggcacacaggcactggtccatgcgatttggatggcaacagtggccgcctgattgaggat
acagagatttggcaagatctggaccttcccagctcactgccagaaatcagtgcttttgag
ttggattcagaagtggcacacttggataacattctacaagagagcaccggtggtggctgt
cctgtcggtggcttgccaaaggaaataaagcctctcatgggtaacggagaaaactgtacc
agtgttaatggcacaaagcagcaacaccatgccctacacccccatcaacaacagcagcag
caccaccaactaatacatcaccagcaacatcagccccagcatcaccagcctcaggccctt
ctctccactatcatcatcaaggaagagaaggatcctgatgagtctttcatccaaatctgt
acccctggtgtgataaaacaggagaagcaggataatggtttctgccagcctcagtgtctc
cagagcggcatcagctctctccacggaggaggaccacgccccatgtcctcacctgtgagt
gtcggcgcagtgcccggctaccactacacagccaacctgagctcaacaatggacatacaa
gaccagaagccttttgacatgtactcaaacatgcctctgatgggggatggctgggcccgg
gggaaaaggtatggagagacatctgggattcagagcagcgatgatgggccctctcctgtc
gcgtccttggcacctttttctgttggcttctccagttcatcacccagagaaggagagatc
agcagctctgtggtacctgcccaatccaagaccagcgggcagactcataagatctgtttg
gtgtgctcagatgaggcctctggatgccattacggggttgtaacatgtggcagctgcaag
gttttcttcaagagagccgttgaaggatggagagcacgacaaaacacagatggccagcac
aactacctgtgtgcagggagaaatgactgcatcattgataagatccgcaggaagaactgt
ccagcctgccgcttcagaaaatgtcttcaagctggaatgaacttggaagcaaggaaaaac
aaaaagctgatcaagatgaaagtgcaccgggctggggcatcagagcccaccattagcaac
atgcctgttccagtcgtacccaggagcatgccccaactcgtgccgaccatgctgtccata
ctgaaggccatagaaccagagatcatctactcgggctatgacagcacactgccagatact
tcatcacggctcatgtctactctcaacaggctagggggacagcaggttgtctctgcagtc
aagtgggccaagtcactaccaggcttccgcaatctgcaccttgatgaccagatgactctg
ctgcagtgctcctggctctttctcatgtctttcagtcttggctggaggtcatacgagcag
tgtaatggcagcatgctttgtttcgcccctgatcttgtcatcaacaaagatcgcatgaag
ctgcccttcatgactgaccagtgcgagcagatgctgaagatctgtaatgagtttgtcaga
ctgcaggtgtcctacgaagagtacctgtgcatgaaggtgctgttactgctcagtacagta
ccaaaagatggcctgaagagtcaagcagtttttgatgagatcaggatgacctatatcaag
gagctgggaaaagccatcgtcaagagggaggagaaccctagtcagaactggcaacgcttc
taccagttaactaagctacttgactccatgcaggagatggtcgagggtcttctccagatc
tgtttctacacctttgtgaataaaaccctcagtgtggaatttccggagatgctggcagag
atcatttccaaccagataccaaaattcaaagatggaaacgtcaaagctctgctgtttcat
cagaaatga

DBGET integrated database retrieval system