KEGG   Maylandia zebra (zebra mbuna): 101480689
Entry
101480689         CDS       T02814                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04068  FoxO signaling pathway
mze04217  Necroptosis
mze04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101480689 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101480689 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101480689 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101480689 (stat3)
Transcription factors [BR:mze03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101480689 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N
Other DBs
NCBI-GeneID: 101480689
NCBI-ProteinID: XP_004552345
UniProt: A0A3P9D8M6
LinkDB
Position
LG4
AA seq 784 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
SATQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPEIPKEEAFGKYCRPEAAPEAEMGGDSTSTIQPYLKTKFICVTPC
PSVFMDLPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEATPGHMDSLTLEMDV
ASPM
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggagaccaggtacctggagcaactctaccac
ttgtacagtgacagcttccccatggagttacgacagtttcttgcgccttggattgagagt
caggactgggcttacgctgccaataaggagtcacatgctacactggtgttccacaacctc
ttgggagaaatagatcagcagtacagccgtttcctgcaggagaacaacgtgctctaccag
cataacctccgcaggattaaacagcatctgcagagcaagtacttggagaaaccgatggat
attgctcgcattgttgcccgctgtttgtgggaagaacagaggctgctgcagactgccacc
tctgctacacaggatggccaggcagcccatcccactggaacagtagtgacagagaagcag
cagatactggagcacaatcttcaagacatcaggaagcgggtccaggatatggaacagaag
atgaaaatgcttgaaaacttgcaagatgactttgatttcaattacaagaccctaaaaagc
caaggagagttgtcccaggatctaaatggaaatagccaggcagctgcaacgaggcagaag
atggcccagctcgagcagatgctgagcgccctggatcagctcaggaggcaaattgttacg
gagatgggaggcttgttgactgccatggactatgtacagaagaacctgacagatgaagaa
ctggctgactggaagaggagacagcagattgcttgtattggaggccctccaaacatctgt
ctcgatcgccttgaaacttggattacatccttggctgagtcccagctccaaattcgtcag
caaatcaagaagctggaagagctccaacagaaggtgtcctacaaaggagaccccatcatt
cagcaccggcccgcacttgaggagaaaattgtggacttgttcagaaacctaatgaagagt
gcttttgtggttgaaagacagccttgcatgcccatgcatccggacagacctctggttatc
aaaacaggcgtgcagttcacaaataaagtcaggttactggtaaagtttcctgagctcaat
taccagctgaaaattaaagtttgcattgataaggaatctggtgatgtggctgcaattcga
ggatcacgaaagtttaacatcctcggtactaacacaaaagttatgaacatggaggagtcc
aacaatggtagcctgtcagcagagtttaaacacttgaccctgcgagaacaaaggtgtggt
aatggtggacggaccaatagcgacgcctctctgattgtcactgaggaactgcatcttatc
acgtttgaaacagaggtctatcaccagggcctgaagatagatctggagacccattccctg
cctgtggtagttatatcaaacatctgccagatgccaaatgcctgggcttcaatcctgtgg
tacaacatgctcactaaccacccaaagaacgtgaacttcttcaccaaacctccagtgggg
acatgggaccaggtggctgaggtgttgagctggcagttctcttccaccaccaagagaggc
ctgaccattgaacagctcaccacattggctgagaaattactaggaccatgtgtcaactac
tctggatgccaaatcacctgggccaagttctgcaaggaaaacatggcaggcaaaggcttc
tccttctgggtgtggcttgacaacattattgacctggtgaaaaagtacattcttgcactg
tggaatgaagggtatatcatgggttttatcagtaaggagagagagagagctattctgagt
ccaaaacctcccggtacctttctgctgcgcttcagcgagagcagcaaggaggggggcatc
acctttacatgggtagagaaagacatcagtggaaagacccagatccagtcagtggagcct
tacaccaagcagcagctcaacagcatgtcgtttgctgacatcatcatgggctacaagatt
atggatgccaccaatatcctggtttcacctcttgtctacctatatcctgagattcccaaa
gaggaagcctttgggaaatactgcaggccagaagcagctcctgaagccgagatgggagga
gactcaacgagcactattcagccttatttgaagacaaagttcatctgcgttaccccgtgt
ccctccgtcttcatggacttgccggacagtgaactgcttgggaacggattcccaggcaca
aactctggaaacaccagtgacctgttccccatgtcaccccggacccttgactccctgatg
cacaacgaagcagaagctactccagggcatatggattcactcactttggaaatggatgta
gcatcgcctatgtga

DBGET integrated database retrieval system