KEGG   Maylandia zebra (zebra mbuna): 101480857
Entry
101480857         CDS       T02814                                 

Definition
(RefSeq) uncharacterized protein LOC101480857
  KO
K05461  KIT ligand
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101480857
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101480857
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101480857
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101480857
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 101480857
NCBI-ProteinID: XP_004548229
UniProt: A0A3P9BPV7
LinkDB
Position
LG17
AA seq 253 aa
MRKKILKAPCLLLSLVTSLNLCSGKFGSPITDDVNKLPVLKQNIPYDYEIPVSYIPKEVA
GTCWVVLNIYPLEQSLRKLASTFGTISTNKDNVLLFIAMLKSLRFTLDHERLEMAMQSFQ
CHYQEHGLLTGPYFDYIRDFLHTAAQGPTDFSCEPPPCLSTEQTPGVHEGNRGDAWSRRS
PLLLVLIPFITCVALIVWLVKSGKRLPVCNTENSQMEPSDTIPTVSISIPLQTLTHAADA
QPEREAIAEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttgaaagcaccttgtctcctcctgagtctggtaacaagtttgaat
ctttgctctggaaaatttgggtcaccaataactgatgatgtgaacaagctgccagtattg
aagcagaatatcccctatgattatgagattcctgttagttacattcccaaagaagtggct
ggcacctgctgggtggtgttaaatatctatccactggagcaaagtcttcggaagctggcc
agcacgtttggcaccatctccaccaacaaagacaacgtactcctcttcattgcaatgctc
aagagtttacgcttcaccttagaccacgagaggctggaaatggcgatgcagagcttccag
tgtcactatcaggaacatggcttactgactggtccttactttgactacatcagagacttt
ttacacactgctgctcaaggaccaactgacttctcctgtgagccaccaccatgccttagt
actgaacaaacaccaggggttcatgaagggaatcgtggggatgcttggtcgagaagatct
cccctgcttttggttctcatccccttcatcacttgtgttgctctcatagtgtggttggtc
aagtctggaaagcgtttaccagtatgcaacactgaaaatagccaaatggaaccttctgac
acgatcccaactgtgtctatctccatcccacttcaaacactcacccacgctgctgacgct
cagccagagcgggaagcgattgctgaacatgaaagtggatga

DBGET integrated database retrieval system