KEGG   Maylandia zebra (zebra mbuna): 101481239
Entry
101481239         CDS       T02814                                 

Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K09782  amphiregulin
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101481239
   04012 ErbB signaling pathway
    101481239
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mze03110]
    101481239
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mze00536]
    101481239
Chaperones and folding catalysts [BR:mze03110]
 Intramolecular chaperones
  Others
   101481239
Glycosaminoglycan binding proteins [BR:mze00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101481239
SSDB
Motif
Pfam: CD34_antigen SUR7 EGF
Other DBs
NCBI-GeneID: 101481239
NCBI-ProteinID: XP_004547013
UniProt: A0A3P9C3A2
LinkDB
Position
LG12
AA seq 233 aa
MNPLILTCFLCFVCSALSAQGSTTTQSGDQVGVTVDLASGEGLQNLHSDDDELEEDGISG
GDDENVSFLDLHPNRDEKKKRKVKGKRRNKHKGKSTTPFNPEHMVFTSGHTSTLRTNEDP
CNTSHLGYCIHGYCKHIDGLHEPVCICMKGYDGERCGIQTLGTVKNEPTETNNAELVQTV
LVVIAVVLSVISCTAILLMTCAHYRSHKNFLASYLGTVSEQEKLQKHPGDVVV
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaaccctctcatcctcacctgtttcctgtgcttcgtctgcagtgctctaagtgctcag
ggatctacaaccacacagtcaggtgaccaagttggagtgactgtcgacctggcctcaggg
gaaggcctccagaatttgcacagcgatgatgatgagttggaagaggacgggatttcagga
ggagatgatgaaaatgtcagcttccttgacttgcatcccaacagagatgagaagaagaaa
aggaaggtcaaaggcaagaggaggaacaaacacaagggcaaaagcacaactcctttcaac
cccgagcacatggtcttcactagtggacatacatccactctcaggaccaatgaggatccc
tgcaacacctcccacctgggctactgcattcatggatactgcaagcacatagacggcctg
catgaaccagtttgtatatgtatgaagggttatgatggagagcgctgtgggatccagact
ctggggacagtgaaaaatgagcccaccgagaccaacaatgctgagctggtgcagacggtc
ttagtggtcatcgccgtggttctttcagtcatcagttgtaccgccatactgcttatgacc
tgtgctcattacaggtcacataaaaacttcctggcttcctaccttggaaccgtgtcagag
caggagaagcttcagaaacaccctggtgacgttgtcgtttga

DBGET integrated database retrieval system