KEGG   Maylandia zebra (zebra mbuna): 101481309Help
Entry
101481309         CDS       T02814                                 

Gene name
kmt2b
Definition
(RefSeq) histone-lysine N-methyltransferase 2B isoform X1
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101481309 (kmt2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101481309 (kmt2b)
   03036 Chromosome and associated proteins [BR:mze03036]
    101481309 (kmt2b)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101481309 (kmt2b)
Transcription factors [BR:mze03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101481309 (kmt2b)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101481309 (kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     101481309 (kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2
Motif
Other DBs
NCBI-GeneID: 101481309
NCBI-ProteinID: XP_004541615
LinkDB All DBs
Position
Unknown
AA seq 3861 aa AA seqDB search
MMAAAGCGSATAAAVGGQGGTATARGRFPGRPWSSRSRLRSEKRWQLGRSGLEADDVTNG
GPRPANLVLSLNEDQSHLRLLGIQESHKILGQAGYSSSGSEEVRSHTHPGGDDFKGFEAE
TKGSKGPILSQQNSSKGDAANTKSKRQSEKLPLKTPAVKAAAPPDPIKDVKSSEQMHGVS
LEAKPAKDCKKGSKGKSTLDRQPAKSRASSAAPRITIKLVAKKKIKTVKEPQKKSAKKLK
MKGDQDEPKTKDIEGDQILSAHVKLKAEPQEDEHGTEDKGGGTVPVRRRGRSALKTTEPV
CQTSAKVVVSDQKSKEKESVDQPDSVKESGTVEPKSHAKKLKHKETAAGQGPEVNQLVTR
RSNRVTNPLSKRATVSAPAAESLSTSDAVVAASKSEASRTAEAKPLAGSNRRRQSRRLNK
NDTVPENQGLSLSETDNSAVQPSDSLPLKNEDTRVPSLKLIKIRNPKYNAQSAGKNTSRK
KKRRKFIWTLTLVKGGSQTPCAENTFTVTPNAVSEVDQPALCDTSVSENLKGIDDESKLD
DTVPQESENTEKNESNQKDSQNNAEEPLEEKTSLQVEVAVEHTAEASPQEITKTDCGKVV
PPLQIKKVSSPGKHKSSKPSFLIQQVSPVAEKMLEREEKEDVLIDQNETNEDKSACLDVD
VTPTRRLRRRTSSLDSSPTKSVSQKPVNTPKRKLRASVQDEDAPQVHVEDSSQVSTEDSS
SQVLPENPCLDLTEEPSQTTFVNSSEIVDKDTSNIAEDPSQLPGDASPPKVENEVEPQIN
EAEPQFSEAKPLPVPSKPRRCRNNKLGKKKSLPRKKAVVSTETAVNTEPVTVDTTNTEPV
QEEDTQPLVTEVSQPETKDCPPPETKQDPVSVEEEQIQPSVKEEMDIQSIESQQSLSLEC
QTSDLNASMASQKKGKKKRKNLIGQRQKHRHRSKDGKFAPLKLPESEQTEEGDGDSSTPL
AANAPSPSFKLIGVHKKYKKKQSSLQFIGSKRPKPKVISKLIDTGLDKDSLKQEETDTLV
DGGQADVAEAQRSKSKFIKNIKHFIMPVVSARSSRVIKTPQRFMDDAGMSVLPRRNSPKK
GLQLGLQIRPGKRRDDGADRAISPILPIDEEDILSEAQLDVDLFSAQDLDESIDLADSLF
SERKSVKNDKNRSLLKNSSFKCHLPEKAGKEVNTLDKSPENKGEDLFSLTPVDKPTELST
DLLDVQKKKSCPKFTKQTTHLKIYQRLKKPQLGLKSKNPTEPDGASKPLQPPVDLAEGLD
DEAMSISLRQRDTSLEKDKSKLKIEDLDTPGVVRKVSVCVRTTNPKSLTLQHGQVEDIAA
KDTAQPHSGELQSVQNSGRCGGISLGSVEKGVPQRARLTGANKRMFNLLRKAKVQLIKID
QQKQLKSSGLLSGPVGARSQDMTSKRQRRKQRVQLHSDVPVKTEPPQVQPQVISPLCQEF
RRAGGPRIKHVCRAASVVLGQPRAMVPDDIPRLSALPLHERSGISPSAVTKDVGSPSESD
SPGLSDPKVTKVKKPSNFVKRKGLGPFGYRSRRCGVCKGCNHEDDCGKCINCLDKPKFGG
PNTKRQCCVYKRCDQIEERKARRLSGRTAPKGSSKRRRSSLSGGHSSNDEGNDSPSGLQS
DGHSPSLRKQPKRVVKPRVYFDLVDYDSDLDDKALSSSASPARRRGVGPRFSQDFVSLEG
FLGDISDDEVRHRKSSSHRVPSARRKPEKVAVVSQGLQSQGPLEQTPPSVLAALAHGFEQ
RTVESSKPTHKIRVDFKEDCALENVWNMSGLSILTSAPPMPPYVCFLCASKGQHEMLYCQ
VCCEPFHKFCLEPAERPSEENKENWCCRRCKFCHVCGRKNRLSKPLLECERCQNCYHASC
LGPNYPKQNKKRKAWVCMTCTRCKSCGVTPGKSWDTEWNHDKGLCPDCSKLYDQGNYCPI
CFKCYEDNDYDSQMMQCGTCNHWVHAKCEDLTDELYEILSSLPESVVYSCRPCSVTQPSA
WRELLYIELRAGVEKVLACLLSSTLTQHLVTCSQCERSVDPDSGIEGKPACDLRAVGKKF
DKGLYTTLKMFHEDVVQVVRKRLEQEEDLPEERRPTALARSYYLKLLEEVFNWFNSQDPK
VWDPCTKDLPVGMLSQAVHPPTTEHVYAQWQEREDLSSRTPLGLLQEDNGQSLDIKEEEA
LSPMSRESSSLNHFKSSRLKFKGKRGRLSKADLDTGWSKDDERQCSLCQKYGDLKSNEAG
RLLYLGQNEWAHVNCCLWSAEVFEEDNGSLLHVHSAVTRGRLMRCERCNQSGATVGCCLT
SCQSNYHFMCARSRQCVFQDDKKVYCYKHRHLISGRMITGQEFEVNRRVYVDFEGISLRR
KFLTGLEPDLINVMIGSLQIENLGVLTELSANKGKLFPVGFQCSRWYWSTVNPLRRCKYT
CTVREVRPIVPEKPVEEMPNQGDNHTIAHSPRPIPVSKTQDTYISECHPTMEETSIPGIH
PKSDHGARPKIPQPRRPAGGMSRPLPSPGVAQPHHILTISDLEETRGVRRHGPHSQTTGL
RSHRSPPPLGPVTGPVTLRTGKNSLPTSPLFPLGAADSLINSTSSRPVGSRGSSSVRSSG
NTAHCNSLFFPQSPWQEGAGNFPSQSLPFSSPVQHLPRSRLSFDLSQSDSVEVPHNFLAS
PEPEDVSPANGTSPQEDLDQQKDEEEFPYSSFHKDPNLSLGQEMRTELEIEETLLNEGVA
MNCGEQIVVEGDDQEEFWGAAQEVQKKKTLVASLPRSAASARDDLGNTSSDEDMEHYFDF
SRTIVSCPGSKDHSKSPSSPSSRPMAQLDGVDDGTESDASIATSDDAQKVNSQTQIQAKK
LNDKNLPDFETASSTQPSKESSDDKRTDSSPVTISEATKDPADGSTQDAPKSFDTSQTSE
TPLVNQEPMLSSPVDNILPNLTTNVPEIPYSEGLLPGSSSGLSSETPLLLERCDTNPQFT
EMLPVLQDTPLETPEPCKALNSSPDCSRFISPAEGASVLMNDLSSTATEAPVAGSADNSQ
CSLLSLLQPSPLMSTDVPNPSQGLVDPLQMYSLPTFSQPPLTSITLQPVTAVQESTTLPS
LEPAKLTTLSPVGDMTQTLLNVVPQNDPSLSATVSLPVYATQTQPLGSTAVSIVSSSAAI
SPLSGLSTHCSAAPTQVQTTSAPMILNGYSSSVQKEATAGHTISINFATPRPTIEPQQPV
VPQALPGHAILTVKEVGGPNVDPTPHVLLVNRLGQIFVKNPESNTFQLPTPNSPSYNCVT
QIASLLQSNALSATLAAAGNMTAPPSVANVTTVPPPLVTPAVQNPSAVTQLLTHKNNDTM
VMSNVKKSRKTSKTPKDETAPDSRKPKKKKDSSASKKSKSSTASGQPALPSENPPMSPAE
SAQAIINQAMASNYTPKWSGLRTMSPSSLVLPPGLLIEPDPPESPRSPSPQPKPVPPPRP
RTHVRMKRVSSLSDRIVTKKSKVDFLQPEPVIEDEERRKPAFPSISSRASGVRIKTPTVK
GVLNLDELKEEHLSDSDSSGSEPWSFMSVSEQGKQQAWEPVGHSTLTDWKKYSGAASASD
DEPPPSDDEGCPTNRDQPHLRFEITSDDGFSVEADTIEVAWKAVTDGVQEARAIARLRPL
TFQWLSGPRMLGLVHDALVFLLEQLEGAHRCQRHSFRFFKQFSQEDDLPVNPSGCARSEL
YLRKSTFDMFNFLASQHRQLPDIGPYDDEEDEVLLKSTRRATSLELPMAMRFRHLKKTSK
EAVGVYRSAIHGRGLFCKRNIEAGEMVIEYAGIVIRSVLTDKREKYYDGKGIGCYMFRID
DFDVVDATMHGNAARFINHSCEPNCYSRVINVEGRKHIVIFALRKIYRGEELTYDYKFPI
EDASNKLNCNCGARRCRRFLN
NT seq 11586 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcagcgggatgcggatcagcaaccgcggctgccgtaggaggccaaggtgga
accgctacggccagaggtcgttttcccggtcggccttggtcatcacgcagtcgtttgcgc
tctgagaagcgttggcaactcgggcgatcgggcttagaagctgatgatgtgactaacgga
gggccaaggcccgcaaacctggttctatcgttaaacgaagaccagtctcacttgcgcttg
cttggaatacaggaaagccacaagatccttggccaggctggatacagctctagtgggagt
gaagaggtgaggtcccacacccacccaggaggggatgatttcaaaggatttgaagctgag
acaaaaggttccaagggacccatattgtctcaacaaaattcttccaaaggtgatgctgcc
aacacaaaatcgaaacgtcaaagtgagaagctaccgcttaaaacgccagcagtgaaggca
gctgcaccacctgacccgataaaagatgtaaagtcttcggagcaaatgcacggcgtgtcc
ctcgaagcaaaaccagcaaaagattgcaagaaaggttcgaaaggaaaaagcaccctggat
cgacagcccgccaagagcagagcttcatcagcagcaccgaggattactataaagttggtg
gccaaaaagaaaatcaaaactgtaaaggagcctcagaaaaaatctgcaaagaagttgaag
atgaaaggagatcaggatgagcctaaaaccaaggacattgagggtgaccagattttaagt
gctcatgtcaaattaaaagctgaaccacaagaggatgagcatggcacagaagataaagga
ggggggacggtacctgtgagaaggcgtgggagatctgctttaaaaacaacagagcctgta
tgccagactagcgccaaagttgtggttagtgaccaaaaatcaaaggagaaagaatctgtt
gatcaacctgattctgtaaaagagagcgggactgtagagccaaaatcacatgcaaagaaa
ttaaagcataaggaaactgctgctggccagggtcctgaagttaatcaactagtgactcgt
aggagcaatagagtcacaaacccactctctaaaagagccacggtgagtgcacctgcagcg
gaaagtttgagtacaagtgatgctgttgtagcagcgtccaagtcagaagcttcgcggaca
gcagaggccaaaccattagcgggaagtaacagacgaaggcaaagcaggaggctgaataaa
aacgatacagtgccagaaaaccaaggtctgtcattgtcagagactgataactcagctgtg
caacccagtgacagtttgcctttgaaaaatgaggacacgagggtcccaagcttaaagtta
ataaagatcagaaaccctaaatacaatgcgcagtccgcggggaagaatacgtctcgaaag
aaaaaacgaagaaaatttatctggactttgacgttagtaaagggaggaagtcagacgcca
tgcgctgaaaacactttcacagtaacacctaatgctgtaagtgaggttgatcagcccgct
ctttgtgataccagtgtcagtgaaaatttaaagggaattgatgatgaatccaaacttgat
gacacagttccacaggagagtgaaaacactgagaaaaatgagagtaatcagaaagattcc
caaaacaacgccgaggagccgttggaggaaaagacctctttacaagttgaagttgcagtg
gaacacacggctgaagcatctccacaagaaatcactaaaacggactgtgggaaagttgtc
ccccctcttcaaattaaaaaagtctcctctcctggcaaacataaaagttcaaagccttct
tttttaattcagcaggtcagccctgtggctgaaaagatgttggaaagagaggagaaagag
gatgttttaatagatcagaatgaaactaatgaggataaatcagcatgtctggatgttgat
gtcacaccaacaagaaggcttaggaggagaacatcaagccttgattcgtcaccaacaaag
tctgtcagtcagaagccggtgaacactccaaaacgaaagcttagagcaagtgtacaggat
gaagatgccccacaggttcatgttgaagattcttctcaggtttcaactgaagattccagt
tcacaagttcttcccgaaaacccttgtcttgatttgactgaggagccatcgcaaacgacc
tttgtaaactcctctgaaattgttgacaaggatacctcaaatattgctgaagacccctca
cagttgccaggtgacgcttccccaccaaaggtggagaatgaggtagaaccacagattaat
gaggccgaaccacagtttagtgaggccaaaccattgcctgtgccttccaagcctagaaga
tgtaggaataacaaactagggaaaaagaagtctcttcccaggaagaaggctgtcgtttcc
actgaaactgctgtcaacacagagcctgttacagttgacactactaacacggagcctgtt
caagaggaagacactcagcctttagtaacagaggtaagccagccggaaacaaaagattgc
cctccgccagagaccaaacaggaccctgtgtcagtggaggaagagcagatacagccatca
gtaaaggaagaaatggacattcagtcaattgaaagtcagcaatctttgtcactggaatgt
caaacgagtgatctaaatgcatcaatggcatctcagaaaaaaggaaaaaagaaacgtaaa
aacttgattggtcagcgccagaaacacagacacaggagcaaagatggaaaatttgcccca
ctcaaattacctgaaagtgaacaaactgaagagggagatggtgacagttctaccccactg
gcagctaacgcaccatccccaagcttcaaacttattggggtacataaaaagtacaaaaag
aagcagtcaagtcttcagtttattggctctaagagaccaaaacctaaagtcatttccaag
ctgatagatacaggacttgacaaagatagtttgaagcaggaggaaacagacacattagtt
gatggggggcaggcagatgttgcagaggctcagcgcagtaagtcaaagttcataaaaaac
attaagcacttcataatgcctgtggtaagtgccagatcctctcgggtgatcaagaccccg
cagaggtttatggatgatgcaggaatgtctgtactgcctcggagaaactccccaaaaaag
ggtttacaactgggcttgcaaatacgtccaggaaagaggcgagatgatggggcagacaga
gcaatatctccaatcctgcctattgatgaggaggacatattgagtgaagctcaactggat
gtcgatctgttttcagctcaggacctcgatgaaagtattgatctcgccgatagcctgttt
tctgagagaaaaagtgtcaaaaatgataagaacaggtctcttctaaagaactcaagtttt
aagtgtcatcttccagaaaaggcaggcaaggaagtgaatacactggacaaatctccagaa
aacaaaggcgaggatctgttttcactgacaccagttgataagcctacagaactatctact
gacctccttgatgttcagaaaaagaaaagctgccctaagttcactaagcaaacgactcac
ctcaagatatatcagaggctgaagaagccacaactgggacttaaaagcaaaaacccaaca
gagcccgatggtgcgagcaaaccactccagcctcctgttgatttagcagaaggacttgat
gatgaagccatgagcattagtcttaggcaacgggatacaagcttagagaaagacaagtcc
aagcttaagatcgaagacctagatacgcctggagtagtgagaaaagtttctgtctgtgtt
aggactactaacccaaagtcactcacattgcaacatggccaagtggaagatatagctgca
aaagacactgcccagcctcactcaggagagttgcagtcagtacagaactcaggcagatgt
gggggcatttctcttgggtctgtggagaagggagtaccacaaagagcacgactcactggt
gcaaataaaagaatgttcaatctcctcaggaaagccaaggttcagcttattaaaattgac
cagcagaaacagcttaagtcgtctgggctgttatctggcccggttggagccaggtctcaa
gatatgacctctaaaagacaaaggaggaagcagagggtgcagcttcattctgacgttcca
gtcaagacagaaccgcctcaagtacaaccgcaagtcatctccccactgtgccaggagttc
cgtagagcaggaggtccacgtatcaagcacgtgtgccgtgctgcatccgtggtcctcggg
cagccacgtgccatggtaccagatgatattcccagacttagtgccttgccactgcatgaa
agatctggcatttccccatcagcggtcactaaagatgttggttctccatctgaatctgac
agtcctgggctgtcagatccaaaggtcaccaaggtcaagaaaccatcaaattttgtaaag
cggaaaggacttggaccgtttgggtaccgatctagaaggtgtggcgtatgcaaaggctgc
aaccacgaagatgattgtggcaagtgcattaactgcctggacaaacccaagtttggtggt
cccaataccaagcggcagtgttgtgtgtataagagatgtgaccaaattgaggagaggaaa
gcacgcagattaagtgggagaacggcacctaaaggttcctctaagcgaaggcgatcctct
ctcagtgggggtcattcaagtaacgacgaagggaatgactcaccgtctggtctccagagt
gacggccacagtccatcattgagaaagcagccgaagcgtgttgttaaaccccgtgtctat
tttgacctggtggattacgactcagatctagatgataaagctctctcgagctctgcctca
ccagcaaggagaagaggtgtcggaccccgtttcagtcaagactttgtgtcgctggaagga
ttcttgggagacatatcagatgatgaggtcaggcatcgaaagtccagttctcaccgtgtg
ccgtcagctcgacgtaaacctgagaaggttgcggtggtctctcagggtctccagtctcag
ggtcctttggagcagactcctcccagtgtcctggctgcattggcccatggatttgagcag
cgaactgtcgaatcttctaaacctactcacaaaatcagggttgattttaaggaggactgt
gctttggagaatgtctggaatatgagtggattaagtatactgacctctgcgcctcccatg
ccaccctatgtctgcttcctttgtgccagtaaagggcaacatgagatgctgtattgccaa
gtgtgctgtgaacctttccacaaattttgccttgagccagcggagcgcccctcagaggag
aacaaagaaaactggtgctgcagacgctgcaagttttgccatgtgtgcggaaggaaaaac
aggctctcaaagcctttattagagtgtgaacgatgccagaactgctatcatgcctcctgt
ttgggaccaaactacccaaaacaaaacaagaagaggaaagcctgggtgtgtatgacatgc
actaggtgcaaaagttgtggcgtcacaccagggaagagttgggacactgagtggaaccat
gacaaaggactatgtccagattgttcaaaactctatgaccagggtaactactgtccaatc
tgcttcaagtgttatgaggacaatgactatgatagtcaaatgatgcagtgtggcacctgc
aaccattgggttcatgccaagtgtgaggatctaacagatgagctgtatgagatcctgtcc
agcctgccagagagtgtagtgtattcatgtcgaccatgtagtgtgacccaacccagtgcc
tggagagagcttctctacattgagctcagggctggggtggagaaggtgctagcatgcttg
ctttcatccaccctcacccagcaccttgttacctgctcacagtgtgaaagatcggtcgac
cctgacagtggcatagaaggaaagccagcctgtgacctccgagctgtaggaaagaagttt
gacaaaggcctttatactacactgaaaatgttccatgaggatgtggtccaggtggtgcga
aagaggctagagcaagaagaagatcttccagaggagcggagacctactgccttggcacga
tcctactacttaaagctgctcgaggaggtatttaattggttcaacagccaagacccaaag
gtgtgggacccttgtaccaaagacttgccagtggggatgttgtcccaggctgttcatcct
cctacaacagagcatgtttatgctcagtggcaggagagagaggatctttcatctagaact
ccactgggactcctgcaggaagacaatggacaaagcttggatataaaggaagaagaggct
ctttctccaatgtctagggaatcttcaagcctgaaccattttaaaagcagcagactcaaa
ttcaaaggaaaaagaggtcggctttcaaaagctgatctagacactggatggtctaaagat
gatgagagacagtgctctttgtgtcaaaaatatggagacctcaaatcgaatgaagcaggc
aggttactgtatttgggccagaatgaatgggctcatgtcaactgctgcctgtggtctgca
gaagtttttgaagaggacaatggctctctgctgcatgtacacagcgctgtcacaagggga
cgtttgatgcgatgtgaacgttgcaatcagtcgggtgccactgtgggctgctgtctgaca
tcttgtcaaagcaactaccacttcatgtgcgcccgctcccgtcagtgtgtcttccaggat
gataaaaaggtctactgctataaacaccgacatctcatcagtggcaggatgataactggt
caggaatttgaagtaaaccgcagagtgtatgttgattttgaggggatcagtctccgcaga
aagttcttgactgggttggagccagaccttatcaacgtgatgatcggttccctacagatt
gaaaatctaggtgtgctgacagaactttcagcgaacaaaggaaaattgtttcctgttggt
tttcagtgttctcggtggtattggagtacggttaacccattgcggcggtgcaaatacaca
tgtacagtccgagaggtccggccaattgtcccagagaagccagttgaggagatgccgaac
cagggagataatcacaccattgctcacagcccccgtccaatacctgtatcaaaaactcaa
gacacttatatatcagagtgccaccccacaatggaggaaacctcgattccaggtatccac
ccaaagtcagatcacggtgcaaggccaaagattccccaacccaggagaccagctggagga
atgtcaagacctctgccttccccaggagtagcccagccccaccacatactgaccattagt
gatctagaagagactcgaggagttcgtcgccacggcccacactcacagacaacaggtctg
cgcagtcacaggtccccccctcctctgggtcctgtaactggaccagtcactctccgcact
ggaaaaaattccctccctacctcccccttgttcccacttggtgcagcagacagcctgata
aattctacgtcatcccgcccagttggaagtagaggttcttcctctgtacgatcctctggg
aatacagcccactgtaactcgttattctttccccagtctccctggcaggaaggtgctgga
aattttccctctcaaagtctacccttctcttcacctgtacaacatttacccagaagtcga
ctgtcgtttgatctaagccagtcggactcagtcgaggtgccacacaacttcttagcttca
ccagagccagaggatgtctctccagcaaatggtacatcaccccaggaggacttggaccaa
cagaaagatgaagaagagtttccctacagttcattccacaaggaccccaacttgagtctg
ggccaagagatgcggacagaacttgaaattgaagaaaccctcttaaatgagggggtggca
atgaattgtggggagcaaatagtggtggaaggtgatgatcaagaggaattttggggagca
gcccaagaagtacagaagaagaagacccttgttgccagtttgccacggtctgcagcctca
gccagggatgacctgggtaacacatcctcagatgaagatatggagcactattttgacttc
tctcgcacaatagtcagctgcccgggatcaaaagatcactcgaagtctccatcctcgcct
tcctctcgacctatggctcaactggatggggtagatgacggcacagagagtgatgcaagt
atagcaaccagtgatgatgctcaaaaagttaacagtcaaactcagatacaagccaaaaaa
ctaaatgataaaaatcttcccgactttgaaaccgctagcagcacacaaccttccaaagaa
tcatctgatgataagcgaacagattcttctccagtcacgatttcagaagccacaaaagat
cccgctgatggttcaacccaagatgcacctaaatcttttgataccagtcaaacctctgaa
acccctttagtaaaccaagagcccatgctttcttctccagttgataacattctgcctaac
ctaactacaaatgtgcctgaaatcccatattcagaggggttattgccaggttccagttca
gggttgtcctctgaaacacctcttcttcttgagagatgtgacactaacccacagttcacc
gaaatgcttcccgtgctgcaagacacaccacttgagacccccgaaccttgtaaagccctg
aactcatcacctgactgcagcaggtttatatcaccagctgagggggctagtgtgttgatg
aatgacttatcatctactgcaacagaggccccagtagcaggttctgctgataacagtcaa
tgctctctgttgagtcttcttcagccttcccctttaatgtcaacagatgtaccaaacccc
tctcaaggactagtagaccctctccagatgtattctttgcctactttcagtcagcctccc
ttaacaagtattacattgcaaccagtgaccgctgtacaagagtcaacaactttaccgtcc
ctggaacctgctaaactgacaactcttagtcccgttggagatatgacacagacactacta
aatgtcgtgcctcagaatgatccaagcttatcagctactgtttctctaccggtgtatgcc
acacaaacacagccactaggctctacagctgtcagcattgtttcctcctctgcagcaata
tcgcctctgtctggactgtcaacacactgttcagctgctcccacacaggtacaaaccacc
tcagctccgatgatcctaaatggttacagttcttctgtccagaaggaagctacagctggc
catacaatctccatcaatttcgctacacccaggccaactatcgaacctcagcaaccagtg
gtaccccaggcattaccgggtcatgccattcttactgtgaaggaggtgggaggtccaaat
gtagaccctacaccacatgtactactggtgaaccgccttgggcagatctttgtgaaaaac
cctgaaagcaacactttccagctgcctactcccaactccccatcctacaactgtgtcact
cagattgctagccttttgcagagcaacgcactgtcagccacactagctgcagctggtaat
atgactgcaccaccatctgtggccaatgtgacgacagtacctcctccactagtcacgcct
gcagttcagaatccatctgctgtcacacaactgctcacacacaaaaacaatgacacaatg
gtaatgtccaatgtgaagaaatcaagaaaaacttcaaaaacaccaaaagatgaaactgct
ccagattcaagaaaaccaaagaagaagaaggattccagcgcgtcaaagaaatctaagtcc
tccacggcctcagggcagcctgctctgccatctgagaatcctcccatgagtcctgctgaa
agtgcccaagcaattattaatcaagcaatggcgagtaactacacccccaagtggagtggg
cttcgaacaatgagcccttcctcactagttttgccacccggcctgttaattgaaccagat
cctccagagtcaccccgctctccatcaccacaacctaaaccagttcccccaccccgccct
cgcacccatgtccgcatgaaaagagtgtcttcactttcagaccgcatcgtcacaaagaaa
tctaaggttgacttcctgcaaccagagcccgtcatcgaggatgaggagcgtcgcaaacca
gcttttccaagcatctccagcagggcctcaggagtccgaatcaagacccccacagtgaaa
ggagtactgaacttggacgagttaaaagaggagcatctaagtgattctgatagctcagga
tcagagccttggagtttcatgtctgtgagtgaacaaggcaaacagcaggcctgggaacca
gtgggacacagcacactgactgactggaagaaatattctggcgctgcttctgcctcagat
gacgaaccacctccatctgatgatgagggatgtccaacgaatagagaccagccacactta
cgattcgagataaccagcgatgacggctttagtgtagaggcagacaccattgaagtggct
tggaaagcagtcacagatggggtgcaggaggctcgagcaattgcaaggttgaggccactg
acgtttcagtggctcagcggtccccgtatgctgggtctggtccatgacgcattagtgttc
ttgctggagcagcttgaaggagctcaccgttgccagcgccatagtttccgtttcttcaaa
cagttcagccaggaggatgatctgcccgtcaaccccagtggctgtgcccgttcggagctt
taccttaggaagtctacatttgatatgttcaacttcctggcttctcagcacagacagctt
cctgacattgggccttacgacgatgaggaagacgaggttcttttgaagtccacgagacga
gccaccagtttggagttgcccatggccatgcgcttcagacatctgaaaaagacttccaag
gaggcagtaggagtgtacaggtctgctatccacggccgtggtcttttctgcaagaggaac
attgaagcaggagagatggttatcgaatacgcgggcatcgtcattcgctccgtgctcact
gataaaagggagaagtactatgatgggaagggtatcggttgttacatgttccgcatcgat
gacttcgacgtagtggatgcgactatgcatggcaacgcggcgaggtttatcaaccactca
tgtgaacctaactgctactctcgagtgatcaacgtggaaggtcggaagcacatcgtcatc
ttcgctcttaggaaaatctacaggggggaggagctcacctacgactacaagttccccatc
gaagacgccagcaacaaactcaactgtaactgtggggcccggagatgtcgtcgtttcctc
aactaa

DBGET integrated database retrieval system