KEGG   Maylandia zebra (zebra mbuna): 101481339Help
Entry
101481339         CDS       T02814                                 

Gene name
nsd3
Definition
(RefSeq) histone-lysine N-methyltransferase NSD3 isoform X1
  KO
K11425  histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101481339 (nsd3)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101481339 (nsd3)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101481339 (nsd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H_2 zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 101481339
NCBI-ProteinID: XP_012773456
LinkDB All DBs
Position
LG12
AA seq 1605 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEGTCDTGSDPGEDGGPSYDAALDAEFPYPP
SASEDMPQVPNGYPPGLGIYEPQAKFSMYSQFPNGSANGYGAIRSYGDHGLVSVEGTVLR
GPGLQERPLSPVSPPLSTHHPHLHHHHHHHPHHHHHSLHIHSNPPHIQTHSHPQSPPPPP
LPTQHHLHQTPHIMTHNLPPPPPLHLPSSSPPPSLVDNTPSSQPTHAPSSASGGVLKKTS
SPEIKLKIIKTYQNGKELFESALCGDLLQELQKESQKNEAAQAQRRHERKKEKRKKSARL
LLQAQEQSLDTSQTQPGTTGQTEDTHVQPPPKEAPPVQTEKPPKTVIKTEPKTPKVPKVH
HPSVIQETGFCKEFVIGDLVWSKVGTYPWWPCMVSSDPQMKVHTRINTRGHREYHVQFFG
SVAERAWIHEKRIVMYQGKQQFDELQSETLRKTTNPVERHKLMKPIPQRERSQWEVGVGH
AEDAFLMTRQERIDNYTFIYVDPDPTEAPPSKKPNIRPEKRSRRSSSSISKKEDRDVKSP
DREQPPRRQLPRRQCSVSNTDDNANSQASSEDKNQRGDQRKTSSPKQNAGCDARAQQDSP
PPVKTWKTAAARKLLPLSITMKRLNVEITKCDWPLIQKKAAASPKKDKEEEKKERVEREG
RQPDLGYCSPEQDSRAKPEPSPEEEEDGDEGEDEGEERRDSPASRRSEEGGLQQTSSPGS
HHSSPQGSQERKLQRRCVRSRSESERGNDLVPKKKTKKEQAEMAPETTLRTGSQKGASEI
SDACKPLKKRSRASTDVEMASSQYRDTSDSDSRGLNDPQGLFGKSLDSPAAADADASDTQ
SVDSGLSRQDSSTSKRDTVCQICEVYGDGLMVCEGDCNKQFHMECLGLSSPPEGRFSCTE
CRTGNHPCFSCKTVGMEVTRCSVSGCGCYYHEDCVRKLPGTTSSPGGGFSCPQHSCSTCC
LERDPQRASKGRLIRCIRCPLAYHTSDSCVAAGSVILTHHIMICSNHGSAKKNGLLSSPV
NVGWCFLCARGLLVQDLTDTILSSYAYKSHYLLTESNRAELKLPMIPSPSSATKKNVGKG
GKLLCCDSCPASFHPECLEMEMPEGSWSCSDCRAGKKPHYKQIVWVKLGNYRWWPAEICN
PRLVPSNIQSLRHDIGDFPVFFFGSHDYYWINQGRVFPYVENDKNFVTGQININKTFKKA
LEEAARRFQELKAQRESREALKQDRNSRKPPPYKFIKSNKPVGKVQVHVADLSEIQRCNC
KPADEHPCSLESQCLNRMLQYECHPQVCPAGDSCENQCFSKRLYAETEVIKTEGCGWGLR
TNQALKKGDFVAEYVGEVIDSEECQQRIKRAHENHVTNFYMLTLTKDRVIDAGPKGNSSR
FINHSCSPNCETQKWTVNGDVRIGIFALCDIEAGTELTFNYNLHCVGNRRTSCHCGSDNC
SGFLGVQPSSAAVTEKEEKARNAKMKQKKRKLRPEGKHTHEYFCFCCGKGGELVMCDRKD
CPKAYHLLCLNLTKPPYGRWECPWHDCSVCSNPASSLCDFCPRSFCRDHEAGALTTSSLD
DRLCCSSHNPLSPLGAKSSSTQQRRSAQSPVRVKEEPESGQPATE
NT seq 4818 nt NT seq  +upstreamnt  +downstreamnt
atggatttctccttctctttcatgcaagggatcatgggaaatacaattcagcaaccccct
cagctcattgactccgccaacatcagacaggaaggcacctgcgacaccggcagtgacccg
ggtgaggatggtggtccctcctacgatgcagccctggatgcagagtttccgtacccgcca
tcggcttcggaggacatgccgcaggtccccaatggctacccgccgggtttgggcatatac
gaaccgcaggctaaattctccatgtactcgcagttccccaacggctctgctaatggctat
ggggccatacggagctacggggaccacggcctcgtgtcggtggaggggaccgtcctgaga
ggtcccggtctccaggaaagacctctgtctcccgtttcacccccactgtccacacatcac
ccacacctccaccaccaccatcatcatcatccccatcaccaccaccattcgctccacatc
cactcaaatccacctcacatacaaacccactcacacccgcagagtcctccaccgccaccc
ctgcccacccagcatcacctacaccagacacctcacatcatgactcacaacctgccccct
cctcccccgttacacctgccttcgtccagtcctcccccctcacttgtggacaacacccct
tcgtctcagcccacgcacgccccatccagtgcttctggtggggtcctgaagaaaaccagc
tctccggagatcaagctgaagatcataaagacgtatcagaacggcaaagagctgttcgag
tctgcgctgtgcggagacctgctgcaagaactgcagaaagagtctcagaagaacgaggcc
gctcaggcgcagcgcagacatgagaggaagaaggagaagaggaaaaagagtgcaagactg
ctgctgcaagctcaggaacagagcctggacacgagccaaacacagccaggtaccacaggc
cagacagaggacacccacgtccagccgccgccaaaagaagcaccgccggtgcagacagag
aagcctccgaagaccgttattaaaaccgaaccaaagacgccgaaggttcctaaggtccat
catccatcagtgatccaggagacaggcttctgtaaggagtttgtaataggagatctggtg
tggtccaaggtgggtacctacccctggtggccctgcatggtgtcctcagacccacagatg
aaggtccacactcgcatcaacaccagaggtcacagggaatatcacgtccagttctttggc
agtgtcgcagagcgagcgtggatccacgagaagaggatagtcatgtaccaggggaagcaa
cagtttgacgagcttcagtcagagacacttcgcaaaaccacaaaccctgtagagagacac
aaactaatgaagcctatccctcagcgggaacgttctcagtgggaggtgggtgttggtcac
gccgaggatgcttttctgatgacgagacaggagcgaattgacaactacaccttcatctat
gtggacccagaccctactgaagccccacccagcaagaaacccaacatcagacctgagaaa
cgaagccggcgctcaagcagctctatcagtaagaaggaggaccgagatgtaaagtcacca
gatagagagcagcctccgcgacggcagcttccacggagacagtgtagtgtttcaaacaca
gatgacaacgcaaactcccaggcctcaagtgaagataagaaccagaggggggaccaacgt
aagaccagctcaccgaaacagaatgccggctgtgatgcacgagcacagcaggactctccg
cctccggtcaaaacgtggaaaacggcagctgccaggaagctgctgcctctttctatcaca
atgaagaggctgaatgtggagatcacaaaatgtgactggcctcttatccagaaaaaagca
gctgcctccccaaagaaggacaaagaagaagagaagaaagagagggtggagagagaaggc
aggcagcccgacctgggatactgctcacctgagcaggacagcagagctaaacctgagccc
agtccagaggaggaggaagatggggatgaaggagaggacgagggagaggagaggagagat
tccccagcgagtcggaggagtgaagagggaggattgcagcagacctcatctccgggatca
caccacagcagtccgcaaggttctcaagagaggaagcttcagcggcggtgtgtcagaagc
aggtctgagtcagagagaggcaacgatctcgtccctaagaagaaaaccaaaaaagagcag
gctgagatggctccagagaccacgctgaggacaggttcacagaaaggagctagtgagatc
tcagatgcgtgcaagccactgaagaagcgaagcagagcatcaacagatgtcgaaatggct
tcatctcagtacagagacacgtctgattcagactccagaggcctcaacgacccgcagggc
ttatttgggaagagtcttgatagtccagcagcagcagatgcagatgcttcagatactcag
tctgtggactctggcctgtcccgtcaggacagcagcaccagcaagagggacactgtgtgc
cagatctgcgaggtgtacggcgatggtttgatggtatgtgaaggtgactgcaacaagcag
tttcacatggagtgtctcggtttgtcgtccccacctgaaggaagatttagctgcacagaa
tgtagaacagggaaccatccttgttttagctgtaaaacagtgggcatggaggtgacgcgc
tgctctgtgtctggatgtggttgttactatcacgaggactgtgtccgtaaactcccggga
accaccagcagcccaggtggaggtttcagctgccctcagcacagttgttcaacctgctgt
ctggagagagacccacaacgagccagtaaaggtcgtctgattcgttgtatccgctgtccg
ttggcctatcacaccagcgacagctgcgtggcggcaggcagtgtcatccttactcaccac
atcatgatctgcagcaaccacggcagcgccaagaagaacggcctcctctcctcccccgtc
aacgtgggatggtgcttcctgtgtgcccgagggctgttagtgcaagaccttactgacacc
atattaagttcatatgcctataagtcccactaccttctgactgagtcaaatcgtgctgag
ttgaaattacctatgattccctctccttcgtcagctaccaaaaagaatgttgggaaagga
ggcaagttgctgtgctgcgactcatgcccagcttccttccacccggagtgtctggagatg
gagatgccggaggggtcgtggtcctgcagcgattgcagggcagggaagaaacctcactac
aaacaaattgtctgggtcaaactaggcaactacaggtggtggcctgcagagatctgcaac
cctcgcctggtgccatcaaacattcagagtcttcggcacgatattggtgacttcccggtt
ttcttctttggctcccatgactactactggatcaaccaaggccgcgtcttcccatatgtg
gagaatgacaagaactttgtcacaggacagatcaatattaacaaaaccttcaagaaagct
ctggaagaagcagcccggcgctttcaggagcttaaggcgcagagggagagcagggaggct
ctaaagcaggaccgcaattctcgcaaaccaccaccctacaagttcatcaagtccaacaag
cctgtggggaaagttcaggtgcacgtggccgacttgtcagaaattcagcgatgcaactgc
aagccagcagacgagcatccctgcagcctggagtcccagtgtctcaaccgcatgctgcag
tacgagtgtcacccacaggtgtgccctgcaggagacagctgtgagaatcagtgtttctcc
aaacggctgtatgcagaaacagaagtgataaagacggaagggtgtggctggggcctcagg
acaaaccaggcactgaagaagggtgactttgtggccgagtatgtgggagaggtgatagac
tcagaagagtgccagcagcgaatcaaacgtgcccatgaaaatcatgtgaccaacttctac
atgctcaccctcaccaaggatcgtgtcatcgacgctggcccaaaaggaaactcgtctcgg
tttattaaccacagctgcagcccaaactgcgaaacccagaagtggacggtaaacggcgac
gttcgtattggaatctttgccctttgtgacatcgaggctggcacagagctgacgtttaac
tacaatctgcactgtgtgggcaacaggagaacgtcgtgtcactgtggatcagacaactgc
tctggatttcttggggtccagccatcgagtgctgcagtgacggagaaagaggaaaaggcc
aggaatgcaaagatgaagcagaagaagcggaaactgcggccggagggcaaacacacacac
gagtacttttgcttctgctgcggaaaaggaggagagctggtgatgtgtgacaggaaggac
tgcccaaaagcgtatcacctgctgtgtctcaacctcaccaaaccgccatacgggcggtgg
gaatgcccgtggcatgactgcagcgtttgcagcaacccggcctcgtctctctgtgacttc
tgccctcgctccttctgccgggatcatgaggcgggggcgctcaccacctcctccctggac
gaccgcctctgttgttccagccacaacccgctcagtcccctgggggccaaatccagctcc
acccagcagcggcgctccgctcagagccccgtcagagtcaaagaggagccggagtcaggc
cagccggccacggagtga

DBGET integrated database retrieval system