KEGG   Maylandia zebra (zebra mbuna): 101481636
Entry
101481636         CDS       T02814                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101481636 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101481636 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101481636 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:mze00536]
    101481636 (fgf1)
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101481636 (fgf1)
Glycosaminoglycan binding proteins [BR:mze00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101481636 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101481636
NCBI-ProteinID: XP_004550404
UniProt: A0A3P9B1M2
LinkDB
Position
LG10
AA seq 182 aa
MLAQRGHCHMTLSQTQGHHAAPSIPQTLCVMSEGDITVLPFGPGSLDLSKQEAQTLTRLY
SMNGGYHLRILPDGTVNGGRQENDTYDILRLKAVSAGVVVIKGEATGRYLAMNRNGRLCG
VQALNDECYFLEKYEENHHNTYRSQKYNWYVALKRNGQPKAGPDTHQGQKAVFFLPRPAG
NM
NT seq 549 nt   +upstreamnt  +downstreamnt
atgctggctcaacgggggcactgtcacatgacattgtcacagacacagggacatcacgct
gctccgtccatacctcaaactctctgtgtgatgtctgagggagacattacagtgctgcct
tttggacctgggtccctggacctgtccaagcaggaagcccagacactgaccaggctctac
agtatgaatggaggctatcacctaaggattttaccagatggaaccgtcaatggtgggagg
caagaaaatgacacatatgacatcctgaggctgaaggctgtgagtgcgggggtggtggtc
atcaaaggtgaggcgacaggaaggtatctggctatgaacagaaatggacgcctctgtgga
gtacaagctctgaacgatgagtgttacttcctggagaaatatgaagagaaccatcacaac
acgtatcgttctcagaagtacaactggtacgtcgccttgaagaggaacggccagcccaaa
gccggaccagacacccaccagggtcagaaggccgtttttttcctgccaaggcctgcaggc
aacatgtaa

DBGET integrated database retrieval system